Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thefu-q6a0i3

Thermobifida cellulosilytica; Thermomonospora fusca (and strain YX) BTA-hydrolase 2 Cutinase AAZ54921 Tfu_0882 TfCut2 Thc_Cut2 PET hydrolase

Comment
Many mutants of TfCut2 tested for imroved PET hydrolysis. Other strains: Thermobifida cellulosilytica; Thermomonospora fusca (and strain YX); Burkholderia cepacia (Pseudomonas cepacia)


Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Thermomonospora fusca
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptosporangiales: N E > Nocardiopsaceae: N E > Thermobifida: N E > Thermobifida fusca: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 5LUJ, 5LUK, 5LUL
No kinetic





11 substrates (e.g. : 2HE(MHET)4, BETE, BETEB... more)
1 inhbitor:
MHET
>3 Genbank links 6 more: CBY05529, JN129499, FR727680
>3 UniProt links 3 more: E9LVH9, J7FCD9, G8GER6
3 Structure : 5LUJ, 5LUL, 5LUK
>3 UniProt links 3 more: E5BBQ2, Q6A0I3, E9LVH9
>3 Interpro links 3 more: E5BBQ2, Q6A0I3, E9LVH9
>3 Prodom links 3 more: E5BBQ2, Q6A0I3, E9LVH9
>3 Pfam links 3 more: E5BBQ2, Q6A0I3, E9LVH9
>3 PIRSF links 3 more: E5BBQ2, Q6A0I3, E9LVH9
>3 SUPERFAM links 3 more: E5BBQ2, Q6A0I3, E9LVH9
Sequence
Graphical view for this peptide sequence: thefu-q6a0i3
Colored MSA for Polyesterase-lipase-cutinase (raw)
MAVMTPRRERSSLLSRALRFTAAAATALVTAVSLAAPAHAANPYERGPNP
TDALLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAVAISPGY
TGTQASVAWLGKRIASHGFVVITIDTNTTLDQPDSRARQLNAALDYMIND
ASSAVRSRIDSSRLAVMGHSMGGGGSLRLASQRPDLKAAIPLTPWHLNKN
WSSVRVPTLIIGADLDTIAPVLTHARPFYNSLPTSISKAYLELDGATHFA
PNIPNKIIGKYSVAWLKRFVDNDTRYTQFLCPGPRDGLFGEVEEYRSTCP
F
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAVMTPRRERSSLLSRALRFTAAAATALVTAVSLAAPAHAANPYERGPNP
TDALLEARSGPFSVSEERASRFGADGFGGGTIYYPRENNTYGAVAISPGY
TGTQASVAWLGKRIASHGFVVITIDTNTTLDQPDSRARQLNAALDYMIND
ASSAVRSRIDSSRLAVMGHSMGGGGSLRLASQRPDLKAAIPLTPWHLNKN
WSSVRVPTLIIGADLDTIAPVLTHARPFYNSLPTSISKAYLELDGATHFA
PNIPNKIIGKYSVAWLKRFVDNDTRYTQFLCPGPRDGLFGEVEEYRSTCP
F


References
12 more
    Title: Enhancement of PET biodegradation by anchor peptide-cutinase fusion protein
    Liu Z, Zhang Y, Wu J
    Ref: Enzyme Microb Technol, 156:110004, 2022 : PubMed

            

    Title: Unveiling the Enzymatic Degradation Process of Biobased Thiophene Polyesters
    Bertolini FA, Soccio M, Weinberger S, Guidotti G, Gazzano M, Guebitz GM, Lotti N, Pellis A
    Ref: Front Chem, 9:771612, 2021 : PubMed

            

    Title: Small cause, large effect: Structural characterization of cutinases from Thermobifida cellulosilytica
    Ribitsch D, Hromic A, Zitzenbacher S, Zartl B, Gamerith C, Pellis A, Jungbauer A, Lyskowski A, Steinkellner G and Guebitz GM <3 more author(s)>
    Ref: Biotechnol Bioeng, 114:2481, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer