thela-m4tp71

 
Thermomyces lanuginosus (Humicola lanuginosa) Lipase TlLIp

Relationship
Family Lipase_3
Block L
Thermomyces lanuginosus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Trichocomaceae: N E > Thermomyces: N E > Thermomyces lanuginosus: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : AGH70111, ABV69591, ABV69592
2 UniProt : M4TP71, B8PQ85
2 UniProtTrembl : M4TP71, B8PQ85
2 Interpro : M4TP71, B8PQ85
2 Prodom : M4TP71, B8PQ85
2 Pfam : M4TP71, B8PQ85
2 PIRSF : M4TP71, B8PQ85
2 SUPERFAM : M4TP71, B8PQ85
2 QuickSwissBlast : M4TP71, B8PQ85
 
Sequence
Graphical view for this peptide sequence: thela-m4tp71
Colored MSA for Lipase_3 (raw)
RPVRRAVPQDLLDQFELFSQYSAAAYCAANNHAPVGSDVTCSENVCPEVD
AADATFLYSFEDSGLGDVTGLLALDNTNKLIVLSFRGSRSVENWIANLAA
DLTEISDICSGCEGHVGFVTSWRSVADTIREQVQNAVNEHPDYRVVFTGH
SLGGALATIAAAALRGNGYNIDVFSYGAPRVGNRAFAEFLTAQTGGTLYR
ITHTNDIVPRLPPRDWGYSHSSPEYWVTSGNDVPVTANDITVVEGIDSTD
GNNQGNIPDIPSHLWYFGPISECD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RPVRRAVPQDLLDQFELFSQYSAAAYCAANNHAPVGSDVTCSENVCPEVD
AADATFLYSFEDSGLGDVTGLLALDNTNKLIVLSFRGSRSVENWIANLAA
DLTEISDICSGCEGHVGFVTSWRSVADTIREQVQNAVNEHPDYRVVFTGH
SLGGALATIAAAALRGNGYNIDVFSYGAPRVGNRAFAEFLTAQTGGTLYR
ITHTNDIVPRLPPRDWGYSHSSPEYWVTSGNDVPVTANDITVVEGIDSTD
GNNQGNIPDIPSHLWYFGPISECD

no DNA




References
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            

    Title: Synergistic chemo-enzymatic hydrolysis of poly(ethylene terephthalate) from textile waste
    Quartinello F, Vajnhandl S, Volmajer Valh J, Farmer TJ, Voncina B, Lobnik A, Herrero Acero E, Pellis A, Guebitz GM
    Ref: Microb Biotechnol, 10:1376, 2017 : PubMed

            

    Title: Engineering of Thermomyces lanuginosus lipase Lip: creation of novel biocatalyst for efficient biosynthesis of chiral intermediate of Pregabalin
    Li XJ, Zheng RC, Ma HY, Zheng YG
    Ref: Applied Microbiology & Biotechnology, 98:2473, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer