Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thema-TM0336

Thermotoga maritima Thermotoga sp. Thermotoga petrophila Thermotoga naphthophila conserved Thermostable Esterase

Comment
Other strains: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099), Thermotoga sp. (strain RQ2), Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) Thermotoga naphthophila (strain ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10)


Relationship
Family|Bacterial_EstLip_FamX
Block| X
Position in NCBI Life Tree|Thermotoga maritima
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Thermotogae [phylum]: N E > Thermotogae [class]: N E > Thermotogales: N E > Thermotogaceae: N E > Thermotoga: N E > Thermotoga maritima: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 4 more: AE001714, AE000512, AGIJ01000003
>3 UniProt links 1 more: Q9WYH1, A5IK81, B9KBW3
>3 UniProt links 1 more: Q9WYH1, A5IK81, B9KBW3
>3 Interpro links 1 more: Q9WYH1, A5IK81, B9KBW3
>3 Prodom links 1 more: Q9WYH1, A5IK81, B9KBW3
>3 Pfam links 1 more: Q9WYH1, A5IK81, B9KBW3
>3 PIRSF links 1 more: Q9WYH1, A5IK81, B9KBW3
>3 SUPERFAM links 1 more: Q9WYH1, A5IK81, B9KBW3
Sequence
Graphical view for this peptide sequence: thema-TM0336
Colored MSA for Bacterial_EstLip_FamX (raw)
MRLTVFLSLFLGVMVFGAFDQEAFLFVQHLTSENFESALNMCSNQVKAQL
SVQSLSNIWNSLKAQLSDFREIAGYEKIIQAEYEIYNFTLKFDRGEISAL
VTMDREGKVAGLFFKQATKTEYELPDYVDPESFEEKDITVNGLPGKITIP
KGSGPFPAVVLVHGSGPNDMDETIGPNKIFKDIAYGLSSKGIIVLRYHKR
TFVEKVDPTTLTVEKEVIEDALEAVKILKERKDVSRVYVLGHSLGAMLTP
EIAERSKADGVVMIAPPARPLEEVMEDQLKYLQSLGLASNVEETLNILEK
LKRKEIPPDEFVLGAPAKYFYDLRERDPASIAKRLTIPMLLIFGGRDYQV
TEKDQEIWLKELSGRENVKILVFDDLNHLMISGEGKSTPVEYMKKGHVDK
RVIDEIARWMVK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLTVFLSLFLGVMVFGAFDQEAFLFVQHLTSENFESALNMCSNQVKAQL
SVQSLSNIWNSLKAQLSDFREIAGYEKIIQAEYEIYNFTLKFDRGEISAL
VTMDREGKVAGLFFKQATKTEYELPDYVDPESFEEKDITVNGLPGKITIP
KGSGPFPAVVLVHGSGPNDMDETIGPNKIFKDIAYGLSSKGIIVLRYHKR
TFVEKVDPTTLTVEKEVIEDALEAVKILKERKDVSRVYVLGHSLGAMLTP
EIAERSKADGVVMIAPPARPLEEVMEDQLKYLQSLGLASNVEETLNILEK
LKRKEIPPDEFVLGAPAKYFYDLRERDPASIAKRLTIPMLLIFGGRDYQV
TEKDQEIWLKELSGRENVKILVFDDLNHLMISGEGKSTPVEYMKKGHVDK
RVIDEIARWMVK


References
    Title: Characterization and structural modeling of a new type of thermostable esterase from Thermotoga maritima
    Levisson M, Van der Oost J, Kengen SW
    Ref: Febs J, 274:2832, 2007 : PubMed

            

    Title: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima
    Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC and Fraser CM <19 more author(s)>
    Ref: Nature, 399:323, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer