Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thesj-AXE1

Thermoanaerobacterium sp., Thermoanaerobacterium thermosaccharolyticum (Clostridium thermosaccharolyticum), xylan esterase 1

Comment
Other strains: Thermoanaerobacterium sp. (strain JW/SL YS485), Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DS 571 / NCIB 9385 / NCA 3814) (Clostridium thermosaccharolyticum)


Relationship
Family|Acetyl-esterase_deacetylase
Block| X
Position in NCBI Life Tree|Thermoanaerobacterium sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Thermoanaerobacterales: N E > Thermoanaerobacterales Family III. Incertae Sedis: N E > Thermoanaerobacterium: N E > Thermoanaerobacterium sp.: N E


Molecular evidence
Database
No mutation
1 structure:
3FCY: Crystal Structure of Acetyl Xylan Esterase 1 from Thermoanaerobacterium sp. JW/SL YS485
No kinetic





1 substrate:
Cephalosporin-C
No inhibitor
2 Genbank : AF001926, CP002171
1 UniProt : D9TMZ1
1 Structure : 3FCY
2 UniProt : O30361, D9TMZ1
2 Interpro : O30361, D9TMZ1
2 Prodom : O30361, D9TMZ1
2 Pfam : O30361, D9TMZ1
2 PIRSF : O30361, D9TMZ1
2 SUPERFAM : O30361, D9TMZ1
Sequence
Graphical view for this peptide sequence: thesj-AXE1
Colored MSA for Acetyl-esterase_deacetylase (raw)
MGLFDMPLQKLREYTGTNPCPEDFDEYWNRALDEMRSVDPKIELKESSFQ
VSFAECYDLYFTGVRGARIHAKYIKPKTEGKHPALIRFHGYSSNSGDWND
KLNYVAAGFTVVAMDVRGQGGQSQDVGGVTGNTLNGHIIRGLDDDADNML
FRHIFLDTAQLAGIVMNMPEVDEDRVGVMGPSQGGGLSLACAALEPRVRK
VVSEYPFLSDYKRVWDLDLAKNAYQEITDYFRLFDPRHERENEVFTKLGY
IDVKNLAKRIKGDVLMCVGLMDQVCPPSTVFAAYNNIQSKKDIKVYPDYG
HEPMRGFGDLAMQFMLELYS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLFDMPLQKLREYTGTNPCPEDFDEYWNRALDEMRSVDPKIELKESSFQ
VSFAECYDLYFTGVRGARIHAKYIKPKTEGKHPALIRFHGYSSNSGDWND
KLNYVAAGFTVVAMDVRGQGGQSQDVGGVTGNTLNGHIIRGLDDDADNML
FRHIFLDTAQLAGIVMNMPEVDEDRVGVMGPSQGGGLSLACAALEPRVRK
VVSEYPFLSDYKRVWDLDLAKNAYQEITDYFRLFDPRHERENEVFTKLGY
IDVKNLAKRIKGDVLMCVGLMDQVCPPSTVFAAYNNIQSKKDIKVYPDYG
HEPMRGFGDLAMQFMLELYS


References
    Title: Isolation, analysis, and expression of two genes from Thermoanaerobacterium sp. strain JW/SL YS485: a beta-xylosidase and a novel acetyl xylan esterase with cephalosporin C deacetylase activity
    Lorenz WW, Wiegel J
    Ref: Journal of Bacteriology, 179:5436, 1997 : PubMed

            

    Title: Purification and characterization of two thermostable acetyl xylan esterases from Thermoanaerobacterium sp. strain JW/SL-YS485
    Shao W, Wiegel J
    Ref: Applied Environmental Microbiology, 61:729, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer