Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thevo-TVG0742213

Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) carboxylesterase

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Thermoplasma volcanium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Thermoplasmata: N E > Thermoplasmatales: N E > Thermoplasmataceae: N E > Thermoplasma: N E > Thermoplasma volcanium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP000993
1 UniProt : Q97AS2
1 UniProt : Q97AS2
1 Interpro : Q97AS2
1 Prodom : Q97AS2
1 Pfam : Q97AS2
1 PIRSF : Q97AS2
1 SUPERFAM : Q97AS2
Sequence
Graphical view for this peptide sequence: thevo-TVG0742213
Colored MSA for Hormone-sensitive_lipase_like (raw)
MNPGCRLRGPMGYPDYLTGPLSLSCINIKTKRNIQKAYFRMFDVNPMPID
PQVRKYLDAMSKVSVPELNKTPIEDLRKIFDTPASGAPKVKISVVEDMIL
DTDAAKLPARLYDDSNSDSLVLYFHGGGFVFGSIETHDSLCRRIAKYSGS
KVISVGYRLGPENKFPVAQIDAFNSYLYVLKRSEELGVDSDKIALMGDSA
GGNLAAVASLMARDKGIKLPRLQVLVYPSTGPDMTSKSYLEYSSIYLTKE
LLNWFSSQYLNSIEDALNPYFSPILADLSGLPEAIVVTDEYDPLLEQGET
YSATLRDSGVPVTSIRVNGMIHGFLSNFHLFRAADVSLMMISGAIHTILE
S
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNPGCRLRGPMGYPDYLTGPLSLSCINIKTKRNIQKAYFRMFDVNPMPID
PQVRKYLDAMSKVSVPELNKTPIEDLRKIFDTPASGAPKVKISVVEDMIL
DTDAAKLPARLYDDSNSDSLVLYFHGGGFVFGSIETHDSLCRRIAKYSGS
KVISVGYRLGPENKFPVAQIDAFNSYLYVLKRSEELGVDSDKIALMGDSA
GGNLAAVASLMARDKGIKLPRLQVLVYPSTGPDMTSKSYLEYSSIYLTKE
LLNWFSSQYLNSIEDALNPYFSPILADLSGLPEAIVVTDEYDPLLEQGET
YSATLRDSGVPVTSIRVNGMIHGFLSNFHLFRAADVSLMMISGAIHTILE
S


Reference
    Title: Archaeal adaptation to higher temperatures revealed by genomic sequence of Thermoplasma volcanium
    Kawashima T, Amano N, Koike H, Makino S, Higuchi S, Kawashima-Ohya Y, Watanabe K, Yamazaki M, Kanehori K and Suzuki M <5 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 97:14257, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer