Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thevo-TVG1026250

Thermoplasma volcanium hypothetical protein tvg1026250

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Thermoplasma volcanium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Thermoplasmata: N E > Thermoplasmatales: N E > Thermoplasmataceae: N E > Thermoplasma: N E > Thermoplasma volcanium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP000994
1 UniProt : Q97A05
1 Interpro : Q97A05
1 Prodom : Q97A05
1 Pfam : Q97A05
1 PIRSF : Q97A05
1 SUPERFAM : Q97A05
Sequence
Graphical view for this peptide sequence: thevo-TVG1026250
Colored MSA for AlphaBeta_hydrolase (raw)
MERKFIKTTFGNLSYLERPGEYPLIFLHGLGGSSNNWLRLDRFLAPRFRL
IFFDLLGHGQSDKPKIEYTVEVQAKAIHEAINSLGISRFSIAGNSYGGWV
SLYLSIHIAKPDKLILIDSAGINKTVGESGEEMIESFVQKVMGVEDGNDE
EVIRNIIRNNAKHEWKIKEEDLKNLSVPTIIIWGTADNILSIDYGRKLHD
LIQNSKLYEIPAAKHTPQRTHPQILAKILNENIV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERKFIKTTFGNLSYLERPGEYPLIFLHGLGGSSNNWLRLDRFLAPRFRL
IFFDLLGHGQSDKPKIEYTVEVQAKAIHEAINSLGISRFSIAGNSYGGWV
SLYLSIHIAKPDKLILIDSAGINKTVGESGEEMIESFVQKVMGVEDGNDE
EVIRNIIRNNAKHEWKIKEEDLKNLSVPTIIIWGTADNILSIDYGRKLHD
LIQNSKLYEIPAAKHTPQRTHPQILAKILNENIV


Reference
    Title: Archaeal adaptation to higher temperatures revealed by genomic sequence of Thermoplasma volcanium
    Kawashima T, Amano N, Koike H, Makino S, Higuchi S, Kawashima-Ohya Y, Watanabe K, Yamazaki M, Kanehori K and Suzuki M <5 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 97:14257, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer