Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: thite-g2rae6

Thielavia terrestris (strain ATCC 38088 / NRRL 8126) (Acremonium alabamense) Carbohydrate esterase family 5 protein TtCut

Comment
Best pNP substrate pNP-C8 Paranitrophenyl-octanoate, pNP-C12 Paranitrophenyl-laurate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Thielavia terrestris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Sordariales: N E > Chaetomiaceae: N E > Thielavia: N E > Thielavia terrestris: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Paranitrophenyl-laurate, Paranitrophenyl-octanoate
No inhibitor
3 Genbank : CP003012, XM_003655969, XP_003656017
1 UniProt : G2RAE6
1 UniProt : G2RAE6
1 Interpro : G2RAE6
1 Prodom : G2RAE6
1 Pfam : G2RAE6
1 PIRSF : G2RAE6
1 SUPERFAM : G2RAE6
Sequence
Graphical view for this peptide sequence: thite-g2rae6
Colored MSA for Cutinase (raw)
MKFLPILCAAGLAAAAPTQPAGEAAVEARQLFSDTANDLENGVSSNCPKV
IFICARGSTETGNLGSSVCPEVANGLKNYYPNQLWVQGVGGAYTADLASN
ALPGGTSTAAMQEAANMFNLAQQKCPNASVAAGGYSQGTAVVAGGIQSLS
AAAKDQIKGVVLFGYTQAQQNHDTIPNFPVDKTMIFCAQGDLVCNGTLIV
TAAHFSYITNGDASTKGPAWLHEKIGDA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFLPILCAAGLAAAAPTQPAGEAAVEARQLFSDTANDLENGVSSNCPKV
IFICARGSTETGNLGSSVCPEVANGLKNYYPNQLWVQGVGGAYTADLASN
ALPGGTSTAAMQEAANMFNLAQQKCPNASVAAGGYSQGTAVVAGGIQSLS
AAAKDQIKGVVLFGYTQAQQNHDTIPNFPVDKTMIFCAQGDLVCNGTLIV
TAAHFSYITNGDASTKGPAWLHEKIGDA


References
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: High-level expression of codon-optimized Thielavia terrestris cutinase suitable for ester biosynthesis and biodegradation
    Duan X, Jiang Z, Liu Y, Yan Q, Xiang M, Yang S
    Ref: Int J Biol Macromol, 135:768, 2019 : PubMed

            

    Title: Comparative genomic analysis of the thermophilic biomass-degrading fungi Myceliophthora thermophila and Thielavia terrestris
    Berka RM, Grigoriev IV, Otillar R, Salamov A, Grimwood J, Reid I, Ishmael N, John T, Darmond C and Tsang A <29 more author(s)>
    Ref: Nat Biotechnol, 29:922, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer