Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tobac-a0a1s3yph0

Nicotiana tabacum (Common tobacco); Nicotiana sylvestris (Wood tobacco) (South American tobacco); Nicotiana attenuata (Coyote tobacco); Nicotiana tomentosiformis. probable carboxylesterase 17

Comment
Other strains: Nicotiana tabacum (Common tobacco); Nicotiana sylvestris (Wood tobacco) (South American tobacco); Nicotiana attenuata (Coyote tobacco); Nicotiana tomentosiformis


Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Nicotiana tabacum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > asterids: N E > lamiids: N E > Solanales: N E > Solanaceae: N E > Nicotianoideae: N E > Nicotianeae: N E > Nicotiana: N E > Nicotiana tabacum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: tobac-a0a1s3yph0
Colored MSA for Plant_carboxylesterase (raw)
MSIVAEAPGYIQVFSDGSVKRFAPEIATASIEPCNGYKSKDVNIDPLKPI
SGRIYLPDFPESGVINQQLPVLVYFHGGGFCIGSTTWLGYHLFLGDLSVA
SKSIILSVDYRLAPENKLPTAYEDCYSALEWLIKNLENEPWLKRADLDQV
FLSGDSAGGNIVHQVAIRAIRNEDFRGRLKGLLPIHPYFGSEKRTELETA
NGSAGEVEMNDMFWRLSLPQGSNRDYFGCNFENAEMSVAEWSRFPAVIVF
VAGSDFLKERGVKYAEFLKKNGVKRVELVEAEGQVHVYHVFHPESEATRL
LQKQMSDFIHSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSIVAEAPGYIQVFSDGSVKRFAPEIATASIEPCNGYKSKDVNIDPLKPI
SGRIYLPDFPESGVINQQLPVLVYFHGGGFCIGSTTWLGYHLFLGDLSVA
SKSIILSVDYRLAPENKLPTAYEDCYSALEWLIKNLENEPWLKRADLDQV
FLSGDSAGGNIVHQVAIRAIRNEDFRGRLKGLLPIHPYFGSEKRTELETA
NGSAGEVEMNDMFWRLSLPQGSNRDYFGCNFENAEMSVAEWSRFPAVIVF
VAGSDFLKERGVKYAEFLKKNGVKRVELVEAEGQVHVYHVFHPESEATRL
LQKQMSDFIHSF


References
    Title: A Conserved Carboxylesterase Inhibits Tobacco mosaic virus (TMV) Accumulation in Nicotiana benthamiana Plants
    Guo S, Wong SM
    Ref: Viruses, 12:, 2020 : PubMed

            

    Title: The tobacco genome sequence and its comparison with those of tomato and potato
    Sierro N, Battey JN, Ouadi S, Bakaher N, Bovet L, Willig A, Goepfert S, Peitsch MC, Ivanov NV
    Ref: Nat Commun, 5:3833, 2014 : PubMed

            

    Title: Reference genomes and transcriptomes of Nicotiana sylvestris and Nicotiana tomentosiformis
    Sierro N, Battey JN, Ouadi S, Bovet L, Goepfert S, Bakaher N, Peitsch MC, Ivanov NV
    Ref: Genome Biol, 14:R60, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer