Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: triad-b3s9x4

Trichoplax adhaerens (Trichoplax reptans) Putative uncharacterized protein

Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Trichoplax adhaerens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Placozoa: N E > Trichoplax: N E > Trichoplax adhaerens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DS985260
1 UniProt : B3S9X4
1 UniProt : B3S9X4
1 Interpro : B3S9X4
1 Pfam : B3S9X4
1 PIRSF : B3S9X4
1 SUPERFAM : B3S9X4
Sequence
Graphical view for this peptide sequence: triad-b3s9x4
Colored MSA for Prolylcarboxypeptidase (raw)
MQKLDHFDHTNTAVWSQRYFVNDTFHKKGGPIFLMLGGEGPASPVWNVAG
AWQIYAKKLNAITIQIEHRYYGQSHPVSDASTPNLKYLSSEQALADAAYF
REYFMTSKNMSADTKWIVFGGSYSGALSAWLRTKYPHLFHASVATSAPIL
AKVDFEQYLQVVTKSLQTAGMACTKNIHNATTIIQGMIKTSAGRKKLSQM
FKTCKPLSKDPNDISTFMQSLAGNFEGIVQYNKDNTGFERHTPATTLTDL
CKIMEKNKPLDGYVKVNSLILKQNGQKCNDVVYKDMIKQMQQSKFQPGIA
GRLWFYQTCTEFGYYQTSDSKKQSFGNMFPIKYWVQQCADVFGKKFSPSY
INGEITMTNNYYGALAIKGTRIVFPNGSIDPWHALGLLKSTDATRPTIFI
KGTAHCANMYPPTSKDPAGLRQARTKILGYLTKWLKEKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQKLDHFDHTNTAVWSQRYFVNDTFHKKGGPIFLMLGGEGPASPVWNVAG
AWQIYAKKLNAITIQIEHRYYGQSHPVSDASTPNLKYLSSEQALADAAYF
REYFMTSKNMSADTKWIVFGGSYSGALSAWLRTKYPHLFHASVATSAPIL
AKVDFEQYLQVVTKSLQTAGMACTKNIHNATTIIQGMIKTSAGRKKLSQM
FKTCKPLSKDPNDISTFMQSLAGNFEGIVQYNKDNTGFERHTPATTLTDL
CKIMEKNKPLDGYVKVNSLILKQNGQKCNDVVYKDMIKQMQQSKFQPGIA
GRLWFYQTCTEFGYYQTSDSKKQSFGNMFPIKYWVQQCADVFGKKFSPSY
INGEITMTNNYYGALAIKGTRIVFPNGSIDPWHALGLLKSTDATRPTIFI
KGTAHCANMYPPTSKDPAGLRQARTKILGYLTKWLKEKS


Reference
    Title: The Trichoplax genome and the nature of placozoans
    Srivastava M, Begovic E, Chapman J, Putnam NH, Hellsten U, Kawashima T, Kuo A, Mitros T, Salamov A and Rokhsar DS <11 more author(s)>
    Ref: Nature, 454:955, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer