Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trier-q3hh38

Trichodesmium erythraeum IMS101 AlphaBeta_hydrolase superfamily

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Trichodesmium erythraeum IMS101
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Microcoleaceae: N E > Trichodesmium: N E > Trichodesmium erythraeum: N E > Trichodesmium erythraeum IMS101: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AABK04000002, ABG51064
1 UniProt : Q114L0
1 Interpro : Q114L0
1 Pfam : Q114L0
1 PIRSF : Q114L0
1 SUPERFAM : Q114L0
Sequence
Graphical view for this peptide sequence: trier-q3hh38
Colored MSA for AlphaBeta_hydrolase (raw)
MQVASGKISFLRPTPFQPELPLFVFLCAMDGTGKLLRSQISSLSTGFDIR
CLSIPQNDLSTWEQLSEKTINLIKIEQKAAPKRPVYLCGESFGGCLALKV
ALNTPELLDKLILVNSATSFSQQPIVKYGSYLTQYLPSYLYQLSVTATLP
FLGALGRIRPEECQALLKAMQSVSQKTAIWRFELMRSFQVKKNQLKNFPK
STLIIASAADRLLPSISQAKFLVKYLPKAEMVILPNSGHACLLEADVDLY
KIIRDQWGSNLV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQVASGKISFLRPTPFQPELPLFVFLCAMDGTGKLLRSQISSLSTGFDIR
CLSIPQNDLSTWEQLSEKTINLIKIEQKAAPKRPVYLCGESFGGCLALKV
ALNTPELLDKLILVNSATSFSQQPIVKYGSYLTQYLPSYLYQLSVTATLP
FLGALGRIRPEECQALLKAMQSVSQKTAIWRFELMRSFQVKKNQLKNFPK
STLIIASAADRLLPSISQAKFLVKYLPKAEMVILPNSGHACLLEADVDLY
KIIRDQWGSNLV



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer