Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trini-Q94806

Trichoplusia ni (Cabbage looper) epoxide hydrolase (EC 3.3.2.3)

Comment
Q27025 is a small peptide slightly different from Q94806


Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Trichoplusia ni
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Noctuoidea: N E > Noctuidae: N E > Plusiinae: N E > Trichoplusia: N E > Trichoplusia ni: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : U73680, U35736
1 UniProt : Q94806
2 UniProt : Q94806, Q27025
2 Interpro : Q94806, Q27025
2 Pfam : Q94806, Q27025
2 PIRSF : Q94806, Q27025
2 SUPERFAM : Q94806, Q27025
Sequence
Graphical view for this peptide sequence: trini-Q94806
Colored MSA for Epoxide_hydrolase (raw)
MGRLLFLVPVLAIVLLPVYYLFLQGPPPLPDLDYNEWWGPESGKQKQDTS
VRPFKINFGENLVKDLKDRLKRTRPLTPPLEGVGFEYGFNTNEINSWLKY
WAEGYNFKERETFLNQFPQFKTNIQGLDIHFIKVTPKVPAGVQVVPMLLL
HGWPGSVREFYESIPLLTAVSKDRDFALEVIVPSLPGYGFSDGAVRPGMG
APHIGIIMRNLMNRLGYKRYFVQGGDWGSVIGTSLATFFPEEVLGYHANI
GLVLSTKAMVWQAIGSVWPSLIMDDLSLVDRIYPLSKTLSFQVRESGYLH
IQASKPDTVGVALTDSPAGLLAYIVEKFSIWTRPELTSKPNGGLDFRFTK
DQLIDNLMMYWTSKSITTSVRLYAESFNIKVLGYQLDDIPTPVPSWFIQG
KYEIAYQPPFVLKLKYPNIVGVTVLDDGGHFFAFELPEVFSKDVLKAVTA
FRKLQKNNEKTDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGRLLFLVPVLAIVLLPVYYLFLQGPPPLPDLDYNEWWGPESGKQKQDTS
VRPFKINFGENLVKDLKDRLKRTRPLTPPLEGVGFEYGFNTNEINSWLKY
WAEGYNFKERETFLNQFPQFKTNIQGLDIHFIKVTPKVPAGVQVVPMLLL
HGWPGSVREFYESIPLLTAVSKDRDFALEVIVPSLPGYGFSDGAVRPGMG
APHIGIIMRNLMNRLGYKRYFVQGGDWGSVIGTSLATFFPEEVLGYHANI
GLVLSTKAMVWQAIGSVWPSLIMDDLSLVDRIYPLSKTLSFQVRESGYLH
IQASKPDTVGVALTDSPAGLLAYIVEKFSIWTRPELTSKPNGGLDFRFTK
DQLIDNLMMYWTSKSITTSVRLYAESFNIKVLGYQLDDIPTPVPSWFIQG
KYEIAYQPPFVLKLKYPNIVGVTVLDDGGHFFAFELPEVFSKDVLKAVTA
FRKLQKNNEKTDL


References
    Title: Cloning and expression of a novel juvenile hormone-metabolizing epoxide hydrolase during larval-pupal metamorphosis of the cabbage looper, Trichoplusia ni
    VanHook Harris S, Marin Thompson D, Linderman RJ, Tomalski MD, Roe RM
    Ref: Insect Molecular Biology, 8:85, 1999 : PubMed

            

    Title: Mechanism of action and cloning of epoxide hydrolase from the cabbage looper, Trichoplusia ni.
    Roe RM, Kallapur V, Linderman RJ, Viviani F, Harris SV, Walker EA, Thompson DM
    Ref: Arch Insect Biochem Physiol, 32:527, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer