Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tripr-a0a2k3lzc6

Trifolium pratense (Red clover). Putative carboxylesterase 6-like protein

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Trifolium pratense
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > 50 kb inversion clade: N E > NPAAA clade: N E > Hologalegina: N E > IRL clade: N E > Trifolieae: N E > Trifolium: N E > Trifolium pratense: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ASHM01045091
1 UniProt : A0A2K3LZC6
1 UniProt : A0A2K3LZC6
1 Interpro : A0A2K3LZC6
1 Prodom : A0A2K3LZC6
1 Pfam : A0A2K3LZC6
1 PIRSF : A0A2K3LZC6
1 SUPERFAM : A0A2K3LZC6
Sequence
Graphical view for this peptide sequence: tripr-a0a2k3lzc6
Colored MSA for Plant_carboxylesterase (raw)
MVQEKKLVEDVYGWLRIYDDGSVDRTWRGPPEAKFMIDPVAPHEQFIEGV
ATRDVTTAMITTNEGSIHRARLYLPEKTTKDNKKLPIVIHFHGGGFCITE
ANSYMYYHVYTKFVRCTRSICVSPFLRQAPEHRLPAAIDDGLATLQWLQL
VARGDACDPWLEEHGDFNKVFLIGDSTGGNLVHEVAARVGSVDLSPVRLV
GAIPIHPGFVRSVRSRSEIELPQSPFQTLDMLDKLLNLALPVGSNKDHPF
TCPMGAAAPPLDGLKLPSFLLCIAEKDLMRDTEMEYYEAMKKANKEIDLF
VSEGMAHAFYLNKIAVDMDPKVSAQMDALIGRVKEFIEKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVQEKKLVEDVYGWLRIYDDGSVDRTWRGPPEAKFMIDPVAPHEQFIEGV
ATRDVTTAMITTNEGSIHRARLYLPEKTTKDNKKLPIVIHFHGGGFCITE
ANSYMYYHVYTKFVRCTRSICVSPFLRQAPEHRLPAAIDDGLATLQWLQL
VARGDACDPWLEEHGDFNKVFLIGDSTGGNLVHEVAARVGSVDLSPVRLV
GAIPIHPGFVRSVRSRSEIELPQSPFQTLDMLDKLLNLALPVGSNKDHPF
TCPMGAAAPPLDGLKLPSFLLCIAEKDLMRDTEMEYYEAMKKANKEIDLF
VSEGMAHAFYLNKIAVDMDPKVSAQMDALIGRVKEFIEKH


References
    Title: Gene Classification and Mining of Molecular Markers Useful in Red Clover (Trifolium pratense) Breeding
    Istvanek J, Dluhosova J, Dluhos P, Patkova L, Nedelnik J, Repkova J
    Ref: Front Plant Sci, 8:367, 2017 : PubMed

            

    Title: Genome assembly and annotation for red clover (Trifolium pratense; Fabaceae)
    Istvanek J, Jaros M, Krenek A, Repkova J
    Ref: Am J Bot, 101:327, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer