Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trisp-e5s773

Trichinella spiralis (Trichina worm) Trichinella pseudospiralis, Putative uncharacterized protein

Comment
Other strains: Trichinella spiralis (Trichina worm); Trichinella pseudospiralis (Parasitic roundworm)


Relationship
Family|Gliotactin
Block| C
Position in NCBI Life Tree|Trichinella spiralis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Enoplea: N E > Dorylaimia: N E > Trichinellida: N E > Trichinellidae: N E > Trichinella: N E > Trichinella spiralis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: trisp-e5s773
Colored MSA for Gliotactin (raw)
MYSFVKIYVLRLYLFYTIQYFSFTYSQNEGSFDLFHTESTTDKVTTELPN
DAYVNIQLGRIIGKKVTIKDVPWTSDRESHEQIPVDQKVREPYPIDPKNT
VTVFTFLGIPYAQKPVGTLRFKPPQQLPRFEEETIYANNFGPSCPQDINA
RPTLNFREPTEHRVDEDCLYLNIFTPQISRSVSTKYPVIVFFHGGGFQVG
TSSDWPGHILASKGLVVVTANYRLGPFGFISLGDKHTGNYGLMDQTLVLK
WVQNYIFAFNGNQDQVTIVGHGSGAVSAGLHMLSYGSEGLFHSVAAMSGS
ELSYHQVITNTMLAYNNTVKLGRQVGCTQQVGADIWDCLLTRSPNDLIEG
VQNMLVEFNRYAFLPVIDGNFLRESPEVLLKRKEVLSPVPYLTGVNRNDG
TEVLLSERDLARVNFIIDRPFLEYKIMDFVLKKNFTTNREAALQAIKHLY
TFWPDLQNNDKTRQEFIHFATDAYYVAPVSKSAQLHSESGSIVYMYVNNY
NFSTGAPNGERFFPAWMGVCHDCDLYLLFGFPWMPKEFLPQNLRSVLWTD
TDKNVSDTFMSMWKQFARRNNPNLLRENIWINYGPRDRYYLNINVTRTLH
QDYEWEHVGFWNIYIGTLYDLYTTTFSPTEASLRKELVGFKATTGIFIIL
CAATLTCAGTLLYLHSIYKRNRPVSVHYVLQKDPQHSFDSN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYSFVKIYVLRLYLFYTIQYFSFTYSQNEGSFDLFHTESTTDKVTTELPN
DAYVNIQLGRIIGKKVTIKDVPWTSDRESHEQIPVDQKVREPYPIDPKNT
VTVFTFLGIPYAQKPVGTLRFKPPQQLPRFEEETIYANNFGPSCPQDINA
RPTLNFREPTEHRVDEDCLYLNIFTPQISRSVSTKYPVIVFFHGGGFQVG
TSSDWPGHILASKGLVVVTANYRLGPFGFISLGDKHTGNYGLMDQTLVLK
WVQNYIFAFNGNQDQVTIVGHGSGAVSAGLHMLSYGSEGLFHSVAAMSGS
ELSYHQVITNTMLAYNNTVKLGRQVGCTQQVGADIWDCLLTRSPNDLIEG
VQNMLVEFNRYAFLPVIDGNFLRESPEVLLKRKEVLSPVPYLTGVNRNDG
TEVLLSERDLARVNFIIDRPFLEYKIMDFVLKKNFTTNREAALQAIKHLY
TFWPDLQNNDKTRQEFIHFATDAYYVAPVSKSAQLHSESGSIVYMYVNNY
NFSTGAPNGERFFPAWMGVCHDCDLYLLFGFPWMPKEFLPQNLRSVLWTD
TDKNVSDTFMSMWKQFARRNNPNLLRENIWINYGPRDRYYLNINVTRTLH
QDYEWEHVGFWNIYIGTLYDLYTTTFSPTEASLRKELVGFKATTGIFIIL
CAATLTCAGTLLYLHSIYKRNRPVSVHYVLQKDPQHSFDSN


Reference
    Title: The draft genome of the parasitic nematode Trichinella spiralis
    Mitreva M, Jasmer DP, Zarlenga DS, Wang Z, Abubucker S, Martin J, Taylor CM, Yin Y, Fulton L and Wilson RK <11 more author(s)>
    Ref: Nat Genet, 43:228, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer