Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trowh-TW083.1

Tropheryma whipplei (strain TW08/27) (Whipple's bacillus) putative hydrolase

Comment
Two sequences homologous concatenated


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Tropheryma whipplei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > unclassified Micrococcales: N E > Tropheryma: N E > Tropheryma whipplei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : BX251410, AE016850
1 UniProt : Q83N39
1 Interpro : Q83N39
1 Prodom : Q83N39
1 Pfam : Q83N39
1 PIRSF : Q83N39
1 SUPERFAM : Q83N39
Sequence
Graphical view for this peptide sequence: trowh-TW083.1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MNNFDASAPIDECRVLGHVNENRFLLLAMHGYSGNNQVMYDTVKSFMPQE
IQAGISIVSLRAPIDLSSVSEGPDEGFAWFLFDESGSYKNSYKTLSQSAK
QILSWLDTKKPAGIGLLGFSQGGAMCMELLRAAPEKFDFAVNISGFVWGP
PRRDDSVLAGGLEKRVRYGDSLVTERRRTEVFWGLGKEDTILPYKVWEAT
QAWLLSVTNPEIRIYPELAHKICDEEVRDISSFLL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNNFDASAPIDECRVLGHVNENRFLLLAMHGYSGNNQVMYDTVKSFMPQE
IQAGISIVSLRAPIDLSSVSEGPDEGFAWFLFDESGSYKNSYKTLSQSAK
QILSWLDTKKPAGIGLLGFSQGGAMCMELLRAAPEKFDFAVNISGFVWGP
PRRDDSVLAGGLEKRVRYGDSLVTERRRTEVFWGLGKEDTILPYKVWEAT
QAWLLSVTNPEIRIYPELAHKICDEEVRDISSFLL


References
    Title: Sequencing and analysis of the genome of the Whipple's disease bacterium Tropheryma whipplei
    Bentley SD, Maiwald M, Murphy LD, Pallen MJ, Yeats CA, Dover LG, Norbertczak HT, Besra GS, Quail MA and Relman DA <8 more author(s)>
    Ref: Lancet, 361:637, 2003 : PubMed

            

    Title: Tropheryma whipplei Twist: a human pathogenic Actinobacteria with a reduced genome
    Raoult D, Ogata H, Audic S, Robert C, Suhre K, Drancourt M, Claverie JM
    Ref: Genome Res, 13:1800, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer