Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tryb2-q389w3

Trypanosoma brucei hypothetical protein

Comment
Other strains: Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972)


Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Trypanosoma brucei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Trypanosoma: N E > Trypanozoon: N E > Trypanosoma brucei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
2Q0X: Alpha/beta hydrolase fold protein of unknown function Trypanosoma brucei
No kinetic





No Substrate
No inhibitor
2 Genbank : CM000208, FN554973
2 UniProt : Q389W3, D0A4E9
1 Structure : 2Q0X
2 UniProt : Q389W3, D0A4E9
2 Interpro : Q389W3, D0A4E9
2 Prodom : Q389W3, D0A4E9
2 Pfam : Q389W3, D0A4E9
2 PIRSF : Q389W3, D0A4E9
2 SUPERFAM : Q389W3, D0A4E9
Sequence
Graphical view for this peptide sequence: tryb2-q389w3
Colored MSA for Duf_1749 (raw)
MYRSRPEPVQGHLFTYYKDPYCKIPVFMMNMDARRCVLWVGGQTESLLSF
DYFTNLAEELQGDWAFVQVEVPSGKIGSGPQDHAHDAEDVDDLIGILLRD
HCMNEVALFATSTGTQLVFELLENSAHKSSITRVILHGVVCDPENPLFTP
EGCAARKEHVEKLMAEGRGEDSLAMLKHYDIPITPARLAGGGFPTLQEAV
WNPCIRKEFDVLRRSVGVIKVPLLLMLAHNVQYKPSDEEVGTVLEGVRDH
TGCNRVTVSYFNDTCDELRRVLKAAESEHVAAILQFLADEDEFRTETEKN
NRIKAAEDEKKRKSVLQVSSFAQAASSVKAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYRSRPEPVQGHLFTYYKDPYCKIPVFMMNMDARRCVLWVGGQTESLLSF
DYFTNLAEELQGDWAFVQVEVPSGKIGSGPQDHAHDAEDVDDLIGILLRD
HCMNEVALFATSTGTQLVFELLENSAHKSSITRVILHGVVCDPENPLFTP
EGCAARKEHVEKLMAEGRGEDSLAMLKHYDIPITPARLAGGGFPTLQEAV
WNPCIRKEFDVLRRSVGVIKVPLLLMLAHNVQYKPSDEEVGTVLEGVRDH
TGCNRVTVSYFNDTCDELRRVLKAAESEHVAAILQFLADEDEFRTETEKN
NRIKAAEDEKKRKSVLQVSSFAQAASSVKAS


References
1 more
    Title: The genome sequence of Trypanosoma brucei gambiense, causative agent of chronic human african trypanosomiasis
    Jackson AP, Sanders M, Berry A, McQuillan J, Aslett MA, Quail MA, Chukualim B, Capewell P, MacLeod A and Hertz-Fowler C <4 more author(s)>
    Ref: PLoS Negl Trop Dis, 4:e658, 2010 : PubMed

            

    Title: The genome of the African trypanosome Trypanosoma brucei
    Berriman M, Ghedin E, Hertz-Fowler C, Blandin G, Renauld H, Bartholomeu DC, Lennard NJ, Caler E, Hamlin NE and El-Sayed NM <92 more author(s)>
    Ref: Science, 309:416, 2005 : PubMed

            

    Title: The genome sequence of Trypanosoma cruzi, etiologic agent of Chagas disease
    El-Sayed NM, Myler PJ, Bartholomeu DC, Nilsson D, Aggarwal G, Tran AN, Ghedin E, Worthey EA, Delcher AL and Andersson B <72 more author(s)>
    Ref: Science, 309:409, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer