Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tryb2-q38cd7

Trypanosoma brucei serine carboxypeptidase III, putative (EC 3.4.16.5)

Comment
Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972)


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Trypanosoma brucei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Trypanosoma: N E > Trypanozoon: N E > Trypanosoma brucei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CM000208
2 UniProt : Q38CD7, D0A1B8
2 UniProt : Q38CD7, D0A1B8
2 Interpro : Q38CD7, D0A1B8
2 Pfam : Q38CD7, D0A1B8
2 PIRSF : Q38CD7, D0A1B8
2 SUPERFAM : Q38CD7, D0A1B8
Sequence
Graphical view for this peptide sequence: tryb2-q38cd7
Colored MSA for Carboxypeptidase_S10 (raw)
MMLCHTSLFLISLLLLLQSASALQAIRRPTLRTTGSGWEPCDPGVNQWSG
YFDIPGEQSDKHYFYWAFGPRDGNPNAPVLLWMTGGPGCSSMFALLAENG
PCLMNETTGDIYNNTYSWNNHAYVIYIDQPAGVGFSYADKADYDKNEAEV
SEDMYNFLQAFFGEHEDLRENDFFVVGESYGGHFAPATAYRINQGNKKGE
GIYIPLAGLAVGNGLTDPYTQYASYPRLAWDWCKEVLGSPCVSSFVHVMM
SAMVPACQSTISACDADNSSSADSSCKLSRVTCGPMVALFSATGLNVYDI
RKTCDGPLCYNTTGVDNFMNREDVQRSLGVDPMTWQACNMEVNLMFAVDW
FKNFNYTISGLLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSEEFV
KAPGTPFSSIDGSAAGLVRSVSSNTSSMHFSFVQVYGAGHMVPMDQPAAA
STIIEKFMRNEPLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMLCHTSLFLISLLLLLQSASALQAIRRPTLRTTGSGWEPCDPGVNQWSG
YFDIPGEQSDKHYFYWAFGPRDGNPNAPVLLWMTGGPGCSSMFALLAENG
PCLMNETTGDIYNNTYSWNNHAYVIYIDQPAGVGFSYADKADYDKNEAEV
SEDMYNFLQAFFGEHEDLRENDFFVVGESYGGHFAPATAYRINQGNKKGE
GIYIPLAGLAVGNGLTDPYTQYASYPRLAWDWCKEVLGSPCVSSFVHVMM
SAMVPACQSTISACDADNSSSADSSCKLSRVTCGPMVALFSATGLNVYDI
RKTCDGPLCYNTTGVDNFMNREDVQRSLGVDPMTWQACNMEVNLMFAVDW
FKNFNYTISGLLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSEEFV
KAPGTPFSSIDGSAAGLVRSVSSNTSSMHFSFVQVYGAGHMVPMDQPAAA
STIIEKFMRNEPLS


References
    Title: The genome of the African trypanosome Trypanosoma brucei
    Berriman M, Ghedin E, Hertz-Fowler C, Blandin G, Renauld H, Bartholomeu DC, Lennard NJ, Caler E, Hamlin NE and El-Sayed NM <92 more author(s)>
    Ref: Science, 309:416, 2005 : PubMed

            

    Title: The genome sequence of Trypanosoma cruzi, etiologic agent of Chagas disease
    El-Sayed NM, Myler PJ, Bartholomeu DC, Nilsson D, Aggarwal G, Tran AN, Ghedin E, Worthey EA, Delcher AL and Andersson B <72 more author(s)>
    Ref: Science, 309:409, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer