Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tryb2-q57u20

Trypanosoma brucei (and brucei gambiense (strain MHOM/CI/86/DAL972)) Putative uncharacterized protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Trypanosoma brucei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Trypanosoma: N E > Trypanozoon: N E > Trypanosoma brucei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AC159458, FN554970
2 UniProt : Q57U20, C9ZRQ9
2 UniProt : Q57U20, C9ZRQ9
2 Interpro : Q57U20, C9ZRQ9
2 Pfam : Q57U20, C9ZRQ9
2 PIRSF : Q57U20, C9ZRQ9
2 SUPERFAM : Q57U20, C9ZRQ9
Sequence
Graphical view for this peptide sequence: tryb2-q57u20
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPSFTHILFFLRFSQSRAVGGREKKPAYSFRSSDRMGNVRAPVKLHSTRV
SNTARVSSPENPVHFIFLHGFLSHGGSLMSLARRLHECLATERMAASVEA
IVVDSRNHGRSPHTSTHTLEDMVADLREWLHWHGYVVAGKRAEGNLMTPR
IIAVGHSMGTLTWAKYLLDHRHGDVHRAPVAGFVSLDMPPLTKSLFPSSL
RNLLHEYIDYMRRVRLSAITDMRSAHEEFNRCGIRDRRLQGFLTTNLQII
RKSGGAPPDVSWRCNLPVLDENLRNGSIFLTDADARVCARGEIDVPILSI
LGAESEVGRHKRLQGLWKGCSIATTEEHILPKAGHNVFYDDLSGTTSLIA
GFARRLETLQTS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPSFTHILFFLRFSQSRAVGGREKKPAYSFRSSDRMGNVRAPVKLHSTRV
SNTARVSSPENPVHFIFLHGFLSHGGSLMSLARRLHECLATERMAASVEA
IVVDSRNHGRSPHTSTHTLEDMVADLREWLHWHGYVVAGKRAEGNLMTPR
IIAVGHSMGTLTWAKYLLDHRHGDVHRAPVAGFVSLDMPPLTKSLFPSSL
RNLLHEYIDYMRRVRLSAITDMRSAHEEFNRCGIRDRRLQGFLTTNLQII
RKSGGAPPDVSWRCNLPVLDENLRNGSIFLTDADARVCARGEIDVPILSI
LGAESEVGRHKRLQGLWKGCSIATTEEHILPKAGHNVFYDDLSGTTSLIA
GFARRLETLQTS


Reference
    Title: The genome sequence of Trypanosoma brucei gambiense, causative agent of chronic human african trypanosomiasis
    Jackson AP, Sanders M, Berry A, McQuillan J, Aslett MA, Quail MA, Chukualim B, Capewell P, MacLeod A and Hertz-Fowler C <4 more author(s)>
    Ref: PLoS Negl Trop Dis, 4:e658, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer