Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tryb2-q57v42

Trypanosoma brucei Putative uncharacterized protein

Relationship
Family|LIDHydrolase
Block| X
Position in NCBI Life Tree|Trypanosoma brucei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Trypanosoma: N E > Trypanozoon: N E > Trypanosoma brucei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AC159447
1 UniProt : Q57V42
1 UniProt : Q57V42
1 Interpro : Q57V42
1 Pfam : Q57V42
1 PIRSF : Q57V42
1 SUPERFAM : Q57V42
Sequence
Graphical view for this peptide sequence: tryb2-q57v42
Colored MSA for LIDHydrolase (raw)
MEEEVNTTSSNLIVTWRSRRCVAPVVEVLQSRPHLLDCLTMFPNGTKALH
SPTTCKKMFVLFPGNPGIVNFYEQFVELLSLKDVDVLVMGYSGHSICDRN
NGKVYGLRDQIDNARDFFDSIQERALSYYGNDIYIGGHSIGAFIAAKILV
VFPCIRRCFSLCGVLSRIQETPNGRHMFFVGGNVIFYYVFVYLVVAVLVL
LPRFVSSWFIRRQAPTLSPVLVSQFIEHYNTGALRNCFSMCREEFQVVRE
PDQQFLGLVGKRMVFYCVQDDGWAPLSHVQEAKELCGDCAGFVVESDPSV
IHAWCLSNNETVIEKGILPFM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEEEVNTTSSNLIVTWRSRRCVAPVVEVLQSRPHLLDCLTMFPNGTKALH
SPTTCKKMFVLFPGNPGIVNFYEQFVELLSLKDVDVLVMGYSGHSICDRN
NGKVYGLRDQIDNARDFFDSIQERALSYYGNDIYIGGHSIGAFIAAKILV
VFPCIRRCFSLCGVLSRIQETPNGRHMFFVGGNVIFYYVFVYLVVAVLVL
LPRFVSSWFIRRQAPTLSPVLVSQFIEHYNTGALRNCFSMCREEFQVVRE
PDQQFLGLVGKRMVFYCVQDDGWAPLSHVQEAKELCGDCAGFVVESDPSV
IHAWCLSNNETVIEKGILPFM



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer