Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tryb2-q7yxi0

Trypanosoma brucei brucei TREU927 lysophospholipase TbAPT-L

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Trypanosoma brucei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Trypanosoma: N E > Trypanozoon: N E > Trypanosoma brucei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AY338241, XM_842376, XP_847469
1 UniProt : Q7YXI0
1 UniProt : Q7YXI0
1 Interpro : Q7YXI0
1 Pfam : Q7YXI0
1 PIRSF : Q7YXI0
1 SUPERFAM : Q7YXI0
Sequence
Graphical view for this peptide sequence: tryb2-q7yxi0
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MFGTPVENLTANQIKEELRTLYGVSDFSGCIEQKDLQEKLEKTRETELIT
HGLKYGPLLQIGNRQSPSGIVTLTHGLGDSANGWESVAVELSRRLPHLLF
LLPTASMQPVGINGGAVMNSWYDIRNVSSGNGVTEDAEAIIMSANYLKSL
AYTASRRYQVPAGRVVYAGFSQGAVISLAAGLTARIAPAGVAALSGYFAA
AEKILPQLCNKSLPVLLCHGTMDNIIPFSAAEKTKETLESLGVGPVTLYS
YPMEHSSHPKEINDLEKFLQQVLPGPSSKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFGTPVENLTANQIKEELRTLYGVSDFSGCIEQKDLQEKLEKTRETELIT
HGLKYGPLLQIGNRQSPSGIVTLTHGLGDSANGWESVAVELSRRLPHLLF
LLPTASMQPVGINGGAVMNSWYDIRNVSSGNGVTEDAEAIIMSANYLKSL
AYTASRRYQVPAGRVVYAGFSQGAVISLAAGLTARIAPAGVAALSGYFAA
AEKILPQLCNKSLPVLLCHGTMDNIIPFSAAEKTKETLESLGVGPVTLYS
YPMEHSSHPKEINDLEKFLQQVLPGPSSKS


References
    Title: Trypanosoma brucei Acyl-Protein Thioesterase-like (TbAPT-L) Is a Lipase with Esterase Activity for Short and Medium-Chain Fatty Acids but Has No Depalmitoylation Activity
    Brown RWB, Sharma AI, Villanueva MR, Li X, Onguka O, Zilbermintz L, Nguyen H, Falk BA, Olson CL and Engman DM <6 more author(s)>
    Ref: Pathogens, 11:, 2022 : PubMed

            

    Title: A novel lipase with dual localisation in Trypanosoma brucei
    Monic SG, Lamy A, Thonnus M, Bizarra-Rebelo T, Bringaud F, Smith TK, Figueiredo LM, Riviere L
    Ref: Sci Rep, 12:4766, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer