Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: trybr-CHR1.412

Trypanosoma brucei possible extracellular phospholipase a1 precursor

Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Trypanosoma brucei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Euglenozoa: N E > Kinetoplastida: N E > Trypanosomatidae: N E > Trypanosoma: N E > Trypanozoon: N E > Trypanosoma brucei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL929603, XP_001219175, CAJ16689
1 UniProt : Q4GY96
1 Interpro : Q4GY96
1 Pfam : Q4GY96
1 PIRSF : Q4GY96
1 SUPERFAM : Q4GY96
Sequence
Graphical view for this peptide sequence: trybr-CHR1.412
Colored MSA for Lipase_3 (raw)
MSEPVDQLLKTYLQSCDYSIDSSSRKKALEMSCLCCHVYGGEGHLPDGWL
VCTREVEGLKKRDESCGFRSELYTNGSKYVLAFAGVHDNRSAFESALQLV
GKSDAYKLAAANAALVVSAFGLSNVSFTGHSLGGGLATAAAVFTGAPAIT
FNPAWLSSSTRSELLKFPSVEVINYVIFAEALDVFQRHPQLLNSVPAGAF
FAGLLSNSKIQQFGTFKYIYCKVIHDRPHYIDAHLIETIIEELRKENGEK
ISASDLAASSLHEDVMGGMAQLVQQKMSVIMEVVASVMSKQFSAGGFGSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEPVDQLLKTYLQSCDYSIDSSSRKKALEMSCLCCHVYGGEGHLPDGWL
VCTREVEGLKKRDESCGFRSELYTNGSKYVLAFAGVHDNRSAFESALQLV
GKSDAYKLAAANAALVVSAFGLSNVSFTGHSLGGGLATAAAVFTGAPAIT
FNPAWLSSSTRSELLKFPSVEVINYVIFAEALDVFQRHPQLLNSVPAGAF
FAGLLSNSKIQQFGTFKYIYCKVIHDRPHYIDAHLIETIIEELRKENGEK
ISASDLAASSLHEDVMGGMAQLVQQKMSVIMEVVASVMSKQFSAGGFGSS


Reference
    Title: The DNA sequence of chromosome I of an African trypanosome: gene content, chromosome organisation, recombination and polymorphism
    Hall N, Berriman M, Lennard NJ, Harris BR, Hertz-Fowler C, Bart-Delabesse EN, Gerrard CS, Atkin RJ, Barron AJ and Melville SE <30 more author(s)>
    Ref: Nucleic Acids Research, 31:4864, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer