Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tubmm-TmEst2

Tuber melanosporum (strain Mel28) (Perigord black truffle).carboxyl esterase 2 (TmelEST2)

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Tuber melanosporum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > Pezizomycetes: N E > Pezizales: N E > Tuberaceae: N E > Tuber: N E > Tuber melanosporum: N E


Molecular evidence
Database
No mutation
2 structures: 5MIF, 5MII
No kinetic





No Substrate
2 inhibitors: PMSF, Triton-X-100
2 Genbank : FN430071, XP_002837188.1
1 UniProt : D5GA36
2 Structure : 5MIF, 5MII
1 UniProt : D5GA36
1 Interpro : D5GA36
1 Prodom : D5GA36
1 Pfam : D5GA36
1 PIRSF : D5GA36
1 SUPERFAM : D5GA36
Sequence
Graphical view for this peptide sequence: tubmm-TmEst2
Colored MSA for Hormone-sensitive_lipase_like (raw)
MRFTILSVLAFSLPLVLAETPAPSCPVTNVTTPQLDPITQAYADAISSRP
SLFAFPLPEIRDGYQSNVSDPSTEFTTKILSLPVGPTGNVTAYLYKPVSG
EREKGKDLLPVIAYFHGGGWVFGGPKSYRGLITNLIRESGAAVFFVDYTL
TPKVAYPVPNEQCYAAVQWLLEHGEKLGVDPTNMGFGGDSAGGELSSSVS
LLSIKRKTPLPKFQVLIYPATDLACESATFKEFPNGPGLTTDEIRFAASL
FTPDPKSRLEDVASPGRASDEDLAKFPETLIVVAEVDPIRQQGEDFGRRL
QKLGVRAAIIRVLGTIHGFASIDVLSEAPGAKATIELIGYKFKKALH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRFTILSVLAFSLPLVLAETPAPSCPVTNVTTPQLDPITQAYADAISSRP
SLFAFPLPEIRDGYQSNVSDPSTEFTTKILSLPVGPTGNVTAYLYKPVSG
EREKGKDLLPVIAYFHGGGWVFGGPKSYRGLITNLIRESGAAVFFVDYTL
TPKVAYPVPNEQCYAAVQWLLEHGEKLGVDPTNMGFGGDSAGGELSSSVS
LLSIKRKTPLPKFQVLIYPATDLACESATFKEFPNGPGLTTDEIRFAASL
FTPDPKSRLEDVASPGRASDEDLAKFPETLIVVAEVDPIRQQGEDFGRRL
QKLGVRAAIIRVLGTIHGFASIDVLSEAPGAKATIELIGYKFKKALH


References
    Title: A family of archaea-like carboxylesterases preferentially expressed in the symbiotic phase of the mychorrizal fungus Tuber melanosporum
    Cavazzini D, Grossi G, Levati E, Vallese F, Montanini B, Bolchi A, Zanotti G, Ottonello S
    Ref: Sci Rep, 7:7628, 2017 : PubMed

            

    Title: Perigord black truffle genome uncovers evolutionary origins and mechanisms of symbiosis
    Martin F, Kohler A, Murat C, Balestrini R, Coutinho PM, Jaillon O, Montanini B, Morin E, Noel B and Wincker P <41 more author(s)>
    Ref: Nature, 464:1033, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer