Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: unkp-CE15

marine Arctic metagenome Carbohydrate esterase MZ0003

Relationship
Family|Glucuronoyl_esterase
Block| X
Position in NCBI Life Tree|unidentified prokaryotic organism
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > unidentified prokaryotic organism: N E


Molecular evidence
Database
No mutation
1 structure:
6EHN: Structure of a CE15 esterase from the marine bacterial metagenome
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A0K2VM55
1 Structure : 6EHN
1 UniProt : A0A0K2VM55
1 Interpro : A0A0K2VM55
1 Prodom : A0A0K2VM55
1 Pfam : A0A0K2VM55
1 PIRSF : A0A0K2VM55
1 SUPERFAM : A0A0K2VM55
Sequence
Graphical view for this peptide sequence: unkp-CE15
Colored MSA for Glucuronoyl_esterase (raw)
MQRTCVLIVLIVTSTMWTPDPDVYAQPRGFNYDEAQVPKYTLPDPLVMVD
GTKVTSAKQWNDKRRDEVQQLFEAYMYGKVPDGETELIFTDAKGERALGG
AAIRKQVKISFGEKEDAPAMDLLIYLPADAKVRVPVFLGLNFHGNHTIHK
DKEIWLTESWVRTNKKFGITKNKANELSRGVAAGRWQIEKAIAKGYGVAT
IYCGDIDPDFNFPSNGIQAYYYKKDQTIPEKGQWGTIAAWAFGLSCAMDY
FETDTDIDHKKVAVLGHSRLGKTSLWAGAIDTRFALTISNCSGCGGAALS
RRRFGETVRRINTSFPHWFCSRFHQYNDKEDKLPIDQHMLIALCAPRPVL
INSATEDKWADPHGEFLAAQGADAVYRMLGTGGLDAKKWPEPNKLVKSTI
GYHLRPGKHDVTARDWDVYIEFADHHMTGGAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQRTCVLIVLIVTSTMWTPDPDVYAQPRGFNYDEAQVPKYTLPDPLVMVD
GTKVTSAKQWNDKRRDEVQQLFEAYMYGKVPDGETELIFTDAKGERALGG
AAIRKQVKISFGEKEDAPAMDLLIYLPADAKVRVPVFLGLNFHGNHTIHK
DKEIWLTESWVRTNKKFGITKNKANELSRGVAAGRWQIEKAIAKGYGVAT
IYCGDIDPDFNFPSNGIQAYYYKKDQTIPEKGQWGTIAAWAFGLSCAMDY
FETDTDIDHKKVAVLGHSRLGKTSLWAGAIDTRFALTISNCSGCGGAALS
RRRFGETVRRINTSFPHWFCSRFHQYNDKEDKLPIDQHMLIALCAPRPVL
INSATEDKWADPHGEFLAAQGADAVYRMLGTGGLDAKKWPEPNKLVKSTI
GYHLRPGKHDVTARDWDVYIEFADHHMTGGAE


References
    Title: Structural insight into a CE15 esterase from the marine bacterial metagenome
    De Santi C, Gani OA, Helland R, Williamson A
    Ref: Sci Rep, 7:17278, 2017 : PubMed

            

    Title: Biochemical Characterization of a Family 15 Carbohydrate Esterase from a Bacterial Marine Arctic Metagenome
    De Santi C, Willassen NP, Williamson A
    Ref: PLoS ONE, 11:e0159345, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer