Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: viban-sast

Vibrio anguillarum (Listonella anguillarum) probable anguibactin biosynthesis thioesterase. AngT

Comment
Other strains: Vibrio anguillarum (strain ATCC 68554 / 775) (Listonella anguillarum)


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Vibrio anguillarum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Vibrionales: N E > Vibrionaceae: N E > Vibrio: N E > Vibrio anguillarum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AY255699, AY312585, M34504
3 UniProt : Q79JZ0, P0DJG9, Q6W4T2
>3 UniProt links 1 more: Q79JZ0, Q6W4T2, P19829
>3 Interpro links 1 more: Q79JZ0, Q6W4T2, P19829
>3 Pfam links 1 more: Q79JZ0, Q6W4T2, P19829
>3 PIRSF links 1 more: Q79JZ0, Q6W4T2, P19829
>3 SUPERFAM links 1 more: Q79JZ0, Q6W4T2, P19829
Sequence
Graphical view for this peptide sequence: viban-sast
Colored MSA for Thioesterase (raw)
MSPLIKLAASSRLHDATHYVLCPFAGGGSGAFRHWRTLSLENEVISVMLY
PGREFRIDDPTVINIGTLAEEMIQALKTCNQRIEDTIIVGHSMGAQVAYE
ASKKLVNQGLFLKGLIISGCQAPHIKGRRLLGECDDKTFIHNLVEIGGCD
PSLAKSPEWWPIFLPALRADFTATEQYIFTSLPNDKEGLPIPTLLISGDQ
DREANFSEIEEWKLWCNKVVDHLVVEGGHFYITEQPQMMLECIRALSTET
TA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPLIKLAASSRLHDATHYVLCPFAGGGSGAFRHWRTLSLENEVISVMLY
PGREFRIDDPTVINIGTLAEEMIQALKTCNQRIEDTIIVGHSMGAQVAYE
ASKKLVNQGLFLKGLIISGCQAPHIKGRRLLGECDDKTFIHNLVEIGGCD
PSLAKSPEWWPIFLPALRADFTATEQYIFTSLPNDKEGLPIPTLLISGDQ
DREANFSEIEEWKLWCNKVVDHLVVEGGHFYITEQPQMMLECIRALSTET
TA


References
8 more
    Title: DNA sequencing of a plasmid with virulence from marine fish pathogen Vibrio anguillarum
    Wu HZ, Zhang HZ, Lu CX, Liang N, Jin HY, Ma Y, Zhang YX
    Ref: Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai), 35:956, 2003 : PubMed

            

    Title: A single amino acid change in AngR, a protein encoded by pJM1-like virulence plasmids, results in hyperproduction of anguibactin.
    Tolmasky ME, Actis LA, Crosa JH
    Ref: Infect Immun, 61:3228, 1993 : PubMed

            

    Title: A regulatory gene, angR, of the iron uptake system of Vibrio anguillarum: similarity with phage P22 cro and regulation by iron.
    Farrell DH, Mikesell P, Actis LA, Crosa JH
    Ref: Gene, 86:45, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer