Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vigra-Vreh3

Vigna radiata (Mung bean) Epoxide hydrolase Vreh3

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Vigna radiata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Phaseoleae: N E > Vigna: N E > Vigna radiata: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
6 structures (e.g. : 5XM6, 5Y5D, 5Y6Y... more)
No kinetic





1 substrate:
o-cresyl-glycidyl-ether
No inhibitor
2 UniProt : A0A0G3F3K2, A0A0R5NGA4
>3 Structure links 3 more: 7CG2, 7CG6, 5Y5D
2 UniProt : A0A0G3F3K2, A0A0R5NGA4
2 Interpro : A0A0G3F3K2, A0A0R5NGA4
2 Prodom : A0A0G3F3K2, A0A0R5NGA4
2 Pfam : A0A0G3F3K2, A0A0R5NGA4
2 PIRSF : A0A0G3F3K2, A0A0R5NGA4
2 SUPERFAM : A0A0G3F3K2, A0A0R5NGA4
Sequence
Graphical view for this peptide sequence: vigra-Vreh3
Colored MSA for Epoxide_hydrolase (raw)
MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSR
GYRAVAPDLRGYGDTEAPVSISSYTGFHIVGDLIALIDLLGVDQVFLVAH
DWGAIIGWYLCTFRPDRVKAYVCLSVPLLHRDPNIRTVDAMRAMYGDDYY
ICRFQKPGEMEAQMAEVGTEYVLKNILTTRKPGPPIFPKGEYGTGFNPDM
PNSLPSWLTQDDLAYYVSKYEKTGFTGPLNYYRNMNLNWELTAPWSGGKI
QVPVKFITGELDMVYTSLNMKEYIHGGGFKQDVPNLEEVIVQKNVAHFNN
QEAAEEINNHIYDFIKKF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSR
GYRAVAPDLRGYGDTEAPVSISSYTGFHIVGDLIALIDLLGVDQVFLVAH
DWGAIIGWYLCTFRPDRVKAYVCLSVPLLHRDPNIRTVDAMRAMYGDDYY
ICRFQKPGEMEAQMAEVGTEYVLKNILTTRKPGPPIFPKGEYGTGFNPDM
PNSLPSWLTQDDLAYYVSKYEKTGFTGPLNYYRNMNLNWELTAPWSGGKI
QVPVKFITGELDMVYTSLNMKEYIHGGGFKQDVPNLEEVIVQKNVAHFNN
QEAAEEINNHIYDFIKKF


References
1 more
    Title: Reprogramming Epoxide Hydrolase to Improve Enantioconvergence in Hydrolysis of Styrene Oxide Scaffolds
    Li FL, Qiu YY, Zheng YC, Chen FF, Kong XD, Xu JH, Yu HL
    Ref: Adv Synth Catal, 362:4699, 2021 : PubMed

            

    Title: Regioselectivity Engineering of Epoxide Hydrolase: Near-Perfect Enantioconvergence through a Single Site Mutation
    Li FL, Kong XD, Chen Q, Zheng YC, Xu Q, Chen FF, Fan LQ, Lin GQ, Zhou J and Xu JH <1 more author(s)>
    Ref: ACS Catal, 8:8314, 2018 : PubMed

            

    Title: Stereoselective Hydrolysis of Epoxides by reVrEH3, a Novel Vigna radiata Epoxide Hydrolase with High Enantioselectivity or High and Complementary Regioselectivity
    Hu D, Tang C, Li C, Kan T, Shi X, Feng L, Wu M
    Ref: Journal of Agricultural and Food Chemistry, 65:9861, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer