Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vitvi-BIG8.1

Vitis vinifera (Grape) putative serine hydrolase

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Vitis vinifera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > rosids incertae sedis: N E > Vitales: N E > Vitaceae: N E > Vitis: N E > Vitis vinifera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF487826, FN595231
1 UniProt : F6H321
2 UniProt : Q8GZM8, F6H321
2 Interpro : Q8GZM8, F6H321
2 Pfam : Q8GZM8, F6H321
2 PIRSF : Q8GZM8, F6H321
2 SUPERFAM : Q8GZM8, F6H321
Sequence
Graphical view for this peptide sequence: vitvi-BIG8.1
Colored MSA for Plant_carboxylesterase (raw)
MSFIGEASAYFKVLSDGSIKRVEWESAPASNDSSSNGYKSKDVIINSTKP
ISARIFLPDVPGSSGRLPVLVYFHGGGFCLGSTTWFGYHTFLGDFAVASQ
SIVLSVDYRHAPENRLPIAYDDCYSSLEWLSCQVSSEPWLERADLSRVFL
SGDSAGGNIVHNVALRTIQEQSCDQVKIKGLLLIHPFFGSEERIEKERAG
GEAENLALTDWMWKLSLPEGSNRDHYWCNYEMAELSRAEWCRFPPAVVYV
AGLDFLKERGVMYAAFLEKNGVEVKLVEAEGEKHVYHMLHPESEATRLLQ
KQMSEFIHNF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSFIGEASAYFKVLSDGSIKRVEWESAPASNDSSSNGYKSKDVIINSTKP
ISARIFLPDVPGSSGRLPVLVYFHGGGFCLGSTTWFGYHTFLGDFAVASQ
SIVLSVDYRHAPENRLPIAYDDCYSSLEWLSCQVSSEPWLERADLSRVFL
SGDSAGGNIVHNVALRTIQEQSCDQVKIKGLLLIHPFFGSEERIEKERAG
GEAENLALTDWMWKLSLPEGSNRDHYWCNYEMAELSRAEWCRFPPAVVYV
AGLDFLKERGVMYAAFLEKNGVEVKLVEAEGEKHVYHMLHPESEATRLLQ
KQMSEFIHNF


References
    Title: The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla
    Jaillon O, Aury JM, Noel B, Policriti A, Clepet C, Casagrande A, Choisne N, Aubourg S, Vitulo N and Wincker P <46 more author(s)>
    Ref: Nature, 449:463, 2007 : PubMed

            

    Title: The carboxylesterase gene family from Arabidopsis thaliana
    Marshall SD, Putterill JJ, Plummer KM, Newcomb RD
    Ref: Journal of Molecular Evolution, 57:487, 2003 : PubMed

            

    Title: Cloning of a grapevine Botrytis-responsive gene that has homology to the tobacco hypersensitivity-related hsr203J
    Bezier A, Lambert B, Baillieul F
    Ref: J Exp Bot, 53:2279, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer