Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vitvi-a5c8m8

Vitis vinifera (Grape) Putative uncharacterized protein

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Vitis vinifera
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > rosids incertae sedis: N E > Vitales: N E > Vitaceae: N E > Vitis: N E > Vitis vinifera: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM486123
1 UniProt : A5C8M8
1 UniProt : A5C8M8
1 Interpro : A5C8M8
1 Pfam : A5C8M8
1 PIRSF : A5C8M8
1 SUPERFAM : A5C8M8
Sequence
Graphical view for this peptide sequence: vitvi-a5c8m8
Colored MSA for Carboxypeptidase_S10 (raw)
MASSLYVYLLVLVLGGALQASVDGHLSHEILARQKADRVKKLPGQPEVGF
RQYAGYVTVNESHGRALFYWFFEATQNPHQKPLLLWLNGGPGCSSIGFGA
TEELGPFFPRXDGKLKFNPHTWNKAKDSYAFLIHWFKRFPQFKPXDFYIA
GESYAGHYVPQLAEVIYDHNKHVSKKLHINLKGFMIGNALLDDDTDQRGM
VSYAWDHAVISDRVFFDIKKACNFSAEPVTEECNIALGKYFEVYEIIDMY
SLYAPTCEDDATSSTTSFVARQLPLIRGNVAPKTFSKFPAWHKRPTGYDP
CASDYTTVYLNRPEVQAALHANVTNIPYPWTHCSNNISFWNDAPASILPI
IKKLVDGGLRIWVFSGDTDGRIPVSSTRLTLRKLGLKTIQEWTPWYTSHE
VGGWTIEYDGLTFVTVRGAGHEVPTFAPKQAFQLIRHFLDNEKLPSTPI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASSLYVYLLVLVLGGALQASVDGHLSHEILARQKADRVKKLPGQPEVGF
RQYAGYVTVNESHGRALFYWFFEATQNPHQKPLLLWLNGGPGCSSIGFGA
TEELGPFFPRXDGKLKFNPHTWNKAKDSYAFLIHWFKRFPQFKPXDFYIA
GESYAGHYVPQLAEVIYDHNKHVSKKLHINLKGFMIGNALLDDDTDQRGM
VSYAWDHAVISDRVFFDIKKACNFSAEPVTEECNIALGKYFEVYEIIDMY
SLYAPTCEDDATSSTTSFVARQLPLIRGNVAPKTFSKFPAWHKRPTGYDP
CASDYTTVYLNRPEVQAALHANVTNIPYPWTHCSNNISFWNDAPASILPI
IKKLVDGGLRIWVFSGDTDGRIPVSSTRLTLRKLGLKTIQEWTPWYTSHE
VGGWTIEYDGLTFVTVRGAGHEVPTFAPKQAFQLIRHFLDNEKLPSTPI


Reference
    Title: A high quality draft consensus sequence of the genome of a heterozygous grapevine variety
    Velasco R, Zharkikh A, Troggio M, Cartwright DA, Cestaro A, Pruss D, Pindo M, FitzGerald LM, Vezzulli S and Viola R <47 more author(s)>
    Ref: PLoS ONE, 2:e1326, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer