Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: weevc-f0p2m3

Weeksella virosa (strain ATCC 43766 / DSM 16922 / JCM 21250 / NBRC 16016 / NCTC 11634 / CL345/78). Prolyl oligopeptidase

Relationship
Family|Glutamyl_Peptidase_S9
Block| X
Position in NCBI Life Tree|Weeksella virosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Bacteroidetes: N E > Flavobacteriia: N E > Flavobacteriales: N E > Flavobacteriaceae: N E > Weeksella: N E > Weeksella virosa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP002455, WP_013598252
1 UniProt : F0P2M3
1 UniProt : F0P2M3
1 Interpro : F0P2M3
1 Prodom : F0P2M3
1 Pfam : F0P2M3
1 PIRSF : F0P2M3
1 SUPERFAM : F0P2M3
Sequence
Graphical view for this peptide sequence: weevc-f0p2m3
Colored MSA for Glutamyl_Peptidase_S9 (raw)
MRKLFYSLLFLSLSIGNLFAQENLPYQQPPIEILQLADANLPPSVYADRK
GENAFFFYRNRYKSIAELSEIEMRLGGLRINPKTNINSRQSYFDHLSAYN
LKTSKEQEIKGLPSNGKFANVIWNRNQTKIAFTNTTENGVELWVVDVKSN
QAKKLTKDNLNANLGRPFTWLEDGESFLVNVLPSDRKGLIDTKEAVPTGP
TISVSDGKEAQNRTYQDLLQNKNDEFNFEQLTRSELYLVTTDGTTTKWKD
AGMYVWSSVSPDGNFISITEMKKPFSYIVPYNRFPQTTTVYDKTGKEVKI
IAEKPLEEDRPKGFMSTSKGVRSLSWRADHPATLVWAEALDEGNAEKKVD
YRDAIYQLSAPFDGEKKLILKTVDRFSGITWGNDQIAIAYDNWWNTRNTS
NYLFNPSDNTQEPKRFFSRNYQDAYNNPGSFVTIDNQFGRQQLFINNQKL
MLEGEGISAEGIMPFIDEFDLKTMKTKRIWRAAKSDKLETIVNVLDPKKG
IVLERIQSKTEFPNLYIRNIFKPKQKPKAVTFHKNPFEAMNGVHKEVITY
KREDGVELSGTLYLPPNYDRKKKEKLPMLMWAYPREFKDPATAGQVTTSP
NQFTYPSYGTPILWAMRGYVVLDDAAFPIIGEGNEEPNDTFVKQLVGNAK
AAIDAVDKLGYIDRTRVGVGGHSYGAFMTANLLTHSDLFAAGIARSGAYN
RTLTPFGFQSEERNYWEAPEVYNTMSPFQNANKMKTPLLLIHGEADNNSG
TFPMQSERYFNALKGLGATARYVVLPKESHGYSARESVLHMLWEQDQWLE
KYVKNKGQETKEEKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKLFYSLLFLSLSIGNLFAQENLPYQQPPIEILQLADANLPPSVYADRK
GENAFFFYRNRYKSIAELSEIEMRLGGLRINPKTNINSRQSYFDHLSAYN
LKTSKEQEIKGLPSNGKFANVIWNRNQTKIAFTNTTENGVELWVVDVKSN
QAKKLTKDNLNANLGRPFTWLEDGESFLVNVLPSDRKGLIDTKEAVPTGP
TISVSDGKEAQNRTYQDLLQNKNDEFNFEQLTRSELYLVTTDGTTTKWKD
AGMYVWSSVSPDGNFISITEMKKPFSYIVPYNRFPQTTTVYDKTGKEVKI
IAEKPLEEDRPKGFMSTSKGVRSLSWRADHPATLVWAEALDEGNAEKKVD
YRDAIYQLSAPFDGEKKLILKTVDRFSGITWGNDQIAIAYDNWWNTRNTS
NYLFNPSDNTQEPKRFFSRNYQDAYNNPGSFVTIDNQFGRQQLFINNQKL
MLEGEGISAEGIMPFIDEFDLKTMKTKRIWRAAKSDKLETIVNVLDPKKG
IVLERIQSKTEFPNLYIRNIFKPKQKPKAVTFHKNPFEAMNGVHKEVITY
KREDGVELSGTLYLPPNYDRKKKEKLPMLMWAYPREFKDPATAGQVTTSP
NQFTYPSYGTPILWAMRGYVVLDDAAFPIIGEGNEEPNDTFVKQLVGNAK
AAIDAVDKLGYIDRTRVGVGGHSYGAFMTANLLTHSDLFAAGIARSGAYN
RTLTPFGFQSEERNYWEAPEVYNTMSPFQNANKMKTPLLLIHGEADNNSG
TFPMQSERYFNALKGLGATARYVVLPKESHGYSARESVLHMLWEQDQWLE
KYVKNKGQETKEEKK


Reference
    Title: Complete genome sequence of Weeksella virosa type strain (9751)
    Lang E, Teshima H, Lucas S, Lapidus A, Hammon N, Deshpande S, Nolan M, Cheng JF, Pitluck S and Kyrpides NC <27 more author(s)>
    Ref: Stand Genomic Sci, 4:81, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer