Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanax-XAC0515

Xanthomonas axonopodis, Xanthomonas campestris, Xanthomonas perforans, Xanthomonas fuscans, hypothetical protein xac0515, xcc0500

Comment
Other strains: Xanthomonas axonopodis (pv. citri) (strain 306), Xanthomonas campestris pv. campestris (strains B100; ATCC 33913 / NCPPB 528 / LMG 568) pv. vesicatoria (strain 85-10), Xanthomonas perforans 91-118, Xanthomonas fuscans subsp. aurantifolii (strains ICPB 11122; ICPB 10535) Long extention in C-term as in yerpe-YPO2814 only n-term Pfam A Abhydrolase_6 28 264


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Xanthomonas axonopodis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas axonopodis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AE011678, AE012147, CP000050
>3 UniProt links 2 more: Q8PQ17, Q8PD45, B0RN29
>3 UniProt links 2 more: Q8PQ17, Q8PD45, B0RN29
>3 Interpro links 2 more: Q8PQ17, Q8PD45, B0RN29
>3 Pfam links 2 more: Q8PQ17, Q8PD45, B0RN29
>3 PIRSF links 2 more: Q8PQ17, Q8PD45, B0RN29
>3 SUPERFAM links 2 more: Q8PQ17, Q8PD45, B0RN29
Sequence
Graphical view for this peptide sequence: xanax-XAC0515
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MRTVLEREFVSFDGVPLFYRHWPLHDAVATGTPRAVVLLHRGHEHSGRVM
HLAEELDMPDAQFFAWDARGNGRSPGVRGDAPGFEALVRDLDSFIAHLRA
THGIAVQDIVVIAQSVGAVVAATWVHDYAPPLRALVLASPAFKVKLYVPF
ARAGLALLHALRGNFFVNSYVKPQWLTHDPARVESYRTDPLITRPISVRV
LLGLYAAADRVVDDAQAITVPTQLLVSGADVVVHRGPQDRFYENLRSPIK
QRHWLPGFFHDTLGERDRAIAIAHIRQFVQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRTVLEREFVSFDGVPLFYRHWPLHDAVATGTPRAVVLLHRGHEHSGRVM
HLAEELDMPDAQFFAWDARGNGRSPGVRGDAPGFEALVRDLDSFIAHLRA
THGIAVQDIVVIAQSVGAVVAATWVHDYAPPLRALVLASPAFKVKLYVPF
ARAGLALLHALRGNFFVNSYVKPQWLTHDPARVESYRTDPLITRPISVRV
LLGLYAAADRVVDDAQAITVPTQLLVSGADVVVHRGPQDRFYENLRSPIK
QRHWLPGFFHDTLGERDRAIAIAHIRQFVQ


References
3 more
    Title: The genome of Xanthomonas campestris pv. campestris B100 and its use for the reconstruction of metabolic pathways involved in xanthan biosynthesis
    Vorholter FJ, Schneiker S, Goesmann A, Krause L, Bekel T, Kaiser O, Linke B, Patschkowski T, Ruckert C and Puhler A <8 more author(s)>
    Ref: J Biotechnol, 134:33, 2008 : PubMed

            

    Title: Comparative and functional genomic analyses of the pathogenicity of phytopathogen Xanthomonas campestris pv. campestris
    Qian W, Jia Y, Ren SX, He YQ, Feng JX, Lu LF, Sun Q, Ying G, Tang DJ and He C <18 more author(s)>
    Ref: Genome Res, 15:757, 2005 : PubMed

            

    Title: Comparison of the genomes of two Xanthomonas pathogens with differing host specificities
    da Silva ACR, Ferro JA, Reinach FC, Farah CS, Furlan LR, Quaggio RB, Monteiro-Vitorello CB, Van Sluys MA, Almeida Jr NF and Kitajima JP <55 more author(s)>
    Ref: Nature, 417:459, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer