Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanax-XAC0736

Xanthomonas axonopodis, Xanthomonas campestris, Xanthomonas oryzae, Xanthomonas, Xanthomonas fuscans, esterase

Comment
Other strains: Xanthomonas axonopodis pv. citri (strain 306), Xanthomonas oryzae pv. oryzae (strains KACC10331 / KXO85; MAFF 311018; PXO99A), Xanthomonas campestris pv. campestris (strains ATCC 33913 / NCPPB 528 / LMG 568; 8004; B100), pv. vesicatoria (strain 85-10), Xanthomonas perforans 91-118, Xanthomonas fuscans subsp. aurantifolii (strains ICPB 10535; ICPB 11122)


Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Xanthomonas axonopodis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas axonopodis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: AE011703, AM039952, AE013598
>3 UniProt links 2 more: Q3BXJ2, Q5GW01, B0RNW8
>3 UniProt links 3 more: Q8PPF0, Q3BXJ2, Q5GW01
>3 Interpro links 3 more: Q8PPF0, Q3BXJ2, Q5GW01
>3 Pfam links 3 more: Q8PPF0, Q3BXJ2, Q5GW01
>3 PIRSF links 3 more: Q8PPF0, Q3BXJ2, Q5GW01
>3 SUPERFAM links 3 more: Q8PPF0, Q3BXJ2, Q5GW01
Sequence
Graphical view for this peptide sequence: xanax-XAC0736
Colored MSA for A85-EsteraseD-FGH (raw)
MERIEHRACFGGWQDVYRHQSHTLNCSMQVGVYLPPQAADGPLPVLYWLS
GLTCTEQNFISKAGAQRYAAEHGVILIAPDTSPRGEDVADADGYDIGKGA
GFYVDATQAPWAAHYRMYDYVVNELPALIEATFATTGARAISGHSMGGHG
ALTIALKNPGRYRSVSAFSPIVAPSQVPWGEKAFGQYLGNDRTTWKAYDA
TALIADAQERLPLLIDQGDADEFLQNQLKTALFEGAAKAAGYPVTVRLQP
GYDHSYYFISSFIGEHIAHHAAALRG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERIEHRACFGGWQDVYRHQSHTLNCSMQVGVYLPPQAADGPLPVLYWLS
GLTCTEQNFISKAGAQRYAAEHGVILIAPDTSPRGEDVADADGYDIGKGA
GFYVDATQAPWAAHYRMYDYVVNELPALIEATFATTGARAISGHSMGGHG
ALTIALKNPGRYRSVSAFSPIVAPSQVPWGEKAFGQYLGNDRTTWKAYDA
TALIADAQERLPLLIDQGDADEFLQNQLKTALFEGAAKAAGYPVTVRLQP
GYDHSYYFISSFIGEHIAHHAAALRG


References
6 more
    Title: The genome sequence of Xanthomonas oryzae pathovar oryzae KACC10331, the bacterial blight pathogen of rice
    Lee BM, Park YJ, Park DS, Kang HW, Kim JG, Song ES, Park IC, Yoon UH, Hahn JH and Go SJ <9 more author(s)>
    Ref: Nucleic Acids Research, 33:577, 2005 : PubMed

            

    Title: Insights into genome plasticity and pathogenicity of the plant pathogenic bacterium Xanthomonas campestris pv. vesicatoria revealed by the complete genome sequence
    Thieme F, Koebnik R, Bekel T, Berger C, Boch J, Buttner D, Caldana C, Gaigalat L, Goesmann A and Kaiser O <19 more author(s)>
    Ref: Journal of Bacteriology, 187:7254, 2005 : PubMed

            

    Title: Comparison of the genomes of two Xanthomonas pathogens with differing host specificities
    da Silva ACR, Ferro JA, Reinach FC, Farah CS, Furlan LR, Quaggio RB, Monteiro-Vitorello CB, Van Sluys MA, Almeida Jr NF and Kitajima JP <55 more author(s)>
    Ref: Nature, 417:459, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer