Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanca-impep

Xanthomonas campestris pv. citri (Xanthomonas citri), pv. campestris, pv. vesicatoria, Xanthomonas oryzae, Xanthomonas axonopodis, Xanthomonas perforans, Xanthomonas vesicatoria, Xanthomonas gardneri, Xanthomonas fuscans , Proline iminopeptidase gene

Comment
The ssequence is the one of the structure. Other strains: Xanthomonas campestris pv. citri (Xanthomonas citri), pv. campestris (strains ATCC 33913 / NCPPB 528 / LMG 568; 8004; B100), pv. vesicatoria (strain 85-10), Xanthomonas oryzae pv. oryzae (strains MAFF 311018; PXO99A), Xanthomonas axonopodis pv. citri (strain 306), Xanthomonas perforans 91-118, Xanthomonas vesicatoria ATCC 35937, Xanthomonas gardneri ATCC 19865, Xanthomonas fuscans subsp. aurantifolii (strains ICPB 11122; ICPB 10535)


Relationship
Family|Proline_iminopeptidase
Block| X
Position in NCBI Life Tree|Xanthomonas campestris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas campestris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1AZW: Xanthomonas campestris proline iminopeptidase
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: Z54150, AE013598, AM039952
>3 UniProt links 6 more: P52279, Q8PNY0, Q3BX37
1 Ncbi-nid : 1749837
1 Ncbi-pid : 1749838
1 Structure : 1AZW
>3 UniProt links 6 more: P52279, Q8PNY0, Q3BX37
>3 Interpro links 6 more: P52279, Q8PNY0, Q3BX37
>3 Pfam links 6 more: P52279, Q8PNY0, Q3BX37
>3 PIRSF links 6 more: P52279, Q8PNY0, Q3BX37
>3 SUPERFAM links 6 more: P52279, Q8PNY0, Q3BX37
Sequence
Graphical view for this peptide sequence: xanca-impep
Colored MSA for Proline_iminopeptidase (raw)
MRTLYPEITPYQQGSLKVDDRHTLYFEQCGNPHGKPVVMLHGGPGGGCND
KMRRFHDPAKYRIVLFDQRGSGRSTPHADLVDNTTWDLVADIERLRTHLG
VDRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFLLRRFELEWFYQEG
ASRLFPDAWEHYLNAIPPVERADLMSAFHRRLTSDDEATRLAAAKAWSVW
EGATSFLHVDEDFVTGHEDAHFALAFARIENHYFVNGGFFEVEDQLLRDA
HRIADIPGVIVHGRYDVVCPLQSAWDLHKAWPKAQLQISPASGHSAFEPE
NVDALVRATDGFA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRTLYPEITPYQQGSLKVDDRHTLYFEQCGNPHGKPVVMLHGGPGGGCND
KMRRFHDPAKYRIVLFDQRGSGRSTPHADLVDNTTWDLVADIERLRTHLG
VDRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFLLRRFELEWFYQEG
ASRLFPDAWEHYLNAIPPVERADLMSAFHRRLTSDDEATRLAAAKAWSVW
EGATSFLHVDEDFVTGHEDAHFALAFARIENHYFVNGGFFEVEDQLLRDA
HRIADIPGVIVHGRYDVVCPLQSAWDLHKAWPKAQLQISPASGHSAFEPE
NVDALVRATDGFA


References
10 more
    Title: Structure of proline iminopeptidase from Xanthomonas campestris pv. citri: a prototype for the prolyl oligopeptidase family
    Medrano FJ, Alonso J, Garcia JL, Romero A, Bode W, Gomis-Ruth FX
    Ref: EMBO Journal, 17:1, 1998 : PubMed

            

    Title: Crystallization and preliminary X-ray diffraction analysis of proline iminopeptidase from Xanthomonas campestris pv. citri
    Medrano FJ, Alonso J, Garcia JL, Bode W, Gomis-Ruth FX
    Ref: FEBS Letters, 400:91, 1997 : PubMed

            

    Title: Proline iminopeptidase gene from Xanthomonas campestris pv. citri
    Alonso J, Garcia JL
    Ref: Microbiology, 142:2951, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer