Gene_locus Report for: xanop-a0a0k0gmb7Xanthomonas oryzae pv. oryzae, Uncharacterized protein Comment strain PXO99A Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas oryzae: N E > Xanthomonas oryzae pv. oryzae: N E
6_AlphaBeta_hydrolase : xanor-q5h1w4Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) hypothetical protein (xoo1704), xanor-q5h5m9Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) hydrolase, xanor-q5h5s2Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) hypothetical protein. abh_upf0017 : xanor-q5gu74Xanthomonas oryzae pv. oryzae (and strains MAFF 311018; PXO99A) hypothetical protein. BioH : xanor-biohXanthomonas oryzae pv. oryzae (and strains MAFF 311018; PXO99A) carboxylesterase bioh (EC 3.1.1.1) (biotin synthesis protein bioh). Carboxymethylbutenolide_lactonase : xanor-q5h5n1Xanthomonas oryzae, Xanthomonas vasicola, Xanthomonas fuscans; Xanthomonas campestris b-ketoadipate enol-lactone hydrolase. Dienelactone_hydrolase : xanor-q5h2y0Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) hypothetical protein. DPP4N_Peptidase_S9 : xanor-q5gvh6Xanthomonas oryzae pv. oryzae dipeptidyl peptidase IV, xanor-q5gy36Xanthomonas oryzae pv. oryzae peptidase, xanor-q5gy47Xanthomonas oryzae pv. oryzae peptidase, xanor-q5h5w8Xanthomonas oryzae pv. oryzae dipeptidyl peptidase IV, xanor-Q93M73Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) putative dipeptidyl peptidase. Epoxide_hydrolase : xanor-q5gyv6Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) beta-ketoadipate enol-lactone hydrolase. Fungal-Bact_LIP : xanor-q5h5j0 Xanthomonas oryzae pv. oryzae Lipase/esterase (Fragment) [lipA] Putative uncharacterized protein. Glutamyl_Peptidase_S9 : xanor-q5gul4Xanthomonas oryzae pv. oryzae hypothetical protein. Haloalkane_dehalogenase-HLD1 : xanor-q5gv06Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) haloalkane dehalogenase HLDIII. Homoserine_transacetylase : xanor-metxXanthomonas oryzae, Xanthomonas perforans, Xanthomonas fuscans, homoserine o-acetyltransferase (homoserine transacetylase) (hta), xanor-q5h1v0Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) homoserine o-acetyltransferase. Lipase_3 : xanor-q5guw6Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) hypothetical protein. LYsophospholipase_carboxylesterase : xanor-q5gvk9Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) carboxylesterase. PHA_synth_III_C : xanor-q5h0p6Xanthomonas oryzae pv. oryzae ( and strain MAFF 311018) poly (3-hydroxybutyric acid) synthase. PHB_depolymerase_PhaZ : xanor-q5h1g5Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) phb depolymerase. PhoPQ_related : xanor-q5h236Xanthomonas oryzae pv. oryzae (and strain MAFF 311018; PXO99A) Putative uncharacterized protein. Proline_iminopeptidase : xanor-q5h5x9Xanthomonas oryzae pv. oryzae cysteine proteinase. Prolyl_oligopeptidase_S9 : xanor-q5guj3Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) dipeptidyl anminopeptidase, xanor-q5gvh5Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) prolyl oligopeptidase family protein. T6SS-TLE3 : xanop-a0a0k0gpc4Xanthomonas oryzae pv. oryzae (strain PXO99A). DUF3274 domain-containing protein. Tannase : xanor-q5h0m2Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) tannase. Thioesterase : xanor-q5gwc8Xanthomonas oryzae pv. oryzae (and strain MAFF 311018) hydrolase. VirJ : xanor-acvBXanthomonas oryzae pv. oryzae; Xanthomonas perforans; Xanthomonas fuscans subsp. aurantifolii, virulence protein, xanor-q5h1l1Xanthomonas oryzae; Xanthomonas campestris virulence protein Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Xanthomonas oryzae pv. oryzicola: N, E.
Xanthomonas oryzae pv. oryzicola BLS256: N, E.
Xanthomonas oryzae pv. oryzae PXO99A: N, E.
Xanthomonas oryzae: N, E.
Xanthomonas oryzae pv. oryzae MAFF 311018: N, E.
Xanthomonas oryzae pv. oryzae KACC 10331: N, E.
Xanthomonas campestris: N, E.
Xanthomonas campestris: N, E.
Xanthomonas campestris pv. campestris: N, E.
Xanthomonas campestris pv. musacearum NCPPB 2005: N, E.
Xanthomonas campestris pv. campestris str. 8004: N, E.
Xanthomonas campestris pv. campestris str. B100: N, E.
Xanthomonas campestris pv. campestris str. ATCC 33913: N, E.
Xanthomonas campestris pv. raphani 756C: N, E.
Xanthomonas campestris pv. viticola: N, E.
Xanthomonas campestris pv. musacearum NCPPB 4379: N, E.
Xanthomonas campestris pv. musacearum NCPPB 4380: N, E.
Xanthomonas campestris pv. musacearum NCPPB 4392: N, E.
Xanthomonas campestris pv. musacearum NCPPB 4394: N, E.
Xanthomonas campestris pv. musacearum NCPPB 4384: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: xanop-a0a0k0gmb7
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MSSASPISPATPRRNPRAQATAATADVLLVHGIWNTTHWLLPLAWRMRAD
GLAPALFGYASVLGGPARAVPCLIERLRASRAQWVVCHSLGGLMTLQALQ
DAPDLPVRRVVCLGSPLCGSAAARGLAQRGGLWAMGRSAAILQQGFARWD
GQAEIGQIAGSVARGVGRWLAPLDGDSDGTVALAETRLPGLRDHCVVRAS
HSGLLRSPEAAAQALAFLRCGRFRS
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSSASPISPATPRRNPRAQATAATADVLLVHGIWNTTHWLLPLAWRMRAD
GLAPALFGYASVLGGPARAVPCLIERLRASRAQWVVCHSLGGLMTLQALQ
DAPDLPVRRVVCLGSPLCGSAAARGLAQRGGLWAMGRSAAILQQGFARWD
GQAEIGQIAGSVARGVGRWLAPLDGDSDGTVALAETRLPGLRDHCVVRAS
HSGLLRSPEAAAQALAFLRCGRFRS
|
|
|
|
