Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanop-a0a0k0gpc4

Xanthomonas oryzae pv. oryzae (strain PXO99A). DUF3274 domain-containing protein

Relationship
Family|T6SS-TLE3
Block| X
Position in NCBI Life Tree|Xanthomonas oryzae pv. oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas oryzae: N E > Xanthomonas oryzae pv. oryzae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP000967, WP_012445925
1 UniProt : A0A0K0GPC4
1 UniProt : A0A0K0GPC4
1 Interpro : A0A0K0GPC4
1 Pfam : A0A0K0GPC4
1 PIRSF : A0A0K0GPC4
1 SUPERFAM : A0A0K0GPC4
Sequence
Graphical view for this peptide sequence: xanop-a0a0k0gpc4
Colored MSA for T6SS-TLE3 (raw)
MTECSYVVAQANALLLPNRMGERLVEVPADRPGIVIFIHGVNDPGAGYPT
VEKGLCQGLNERLSRIDLRAGQYGVKYAEAKKSPLKPGEQGYKEVASVKY
DPDTYLYQRSEDTTSKLPTHSMFIPFYWGYRASDNEIAKDKRGNPTRLRS
QYQDTAGNRLDANFAKAGGFFVNATSNLPDMYGKGFETTLKTRGVQMVSP
DFTYFGNAPPRRYFVLAAERLAMLVSEIRRLAPDDTITIMGHSQGTMITL
LAQAMLADRRQRCADCLILVDSPYSLLEPKGEEQTTQAKLQTLIKIVKAV
TAQPYTRPALNELQVGQPGYGGRTGHGWTPSQGTRLDAEGKQIVFAERDN
RGKVYLYFCPQDTTVALDQVQGIGTYGVPDTVHVAWKRKFYSTERTASLP
AMDALKDMRFHQRMWTKLLRGGKPVAVGLPPQHIPLRMEDEARYPGGGVG
PTTTASQTPLPQEGRYINGEALQPPHAPQMEDGEADARQYKSSTPLRGTP
TRAGKDAPDDVSVDVALGNPKASLNQYRVFERFVDKNLSDPDLQELTQQF
NANHPDLNDQTPGYDCENGDDMGYMLWRHATPNEVRAQMAHNPAALVDNS
YHSAMLRSTENHRWVTAMDVAIGQAQTLDDPEWRKVLIAFANWRTPFKPS
ESQLPGQLTLLELANFEKLSPGAQMLAQQTAYYYTTGKFPDGVSKEPPDK
YVISRTRAQRAESNE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTECSYVVAQANALLLPNRMGERLVEVPADRPGIVIFIHGVNDPGAGYPT
VEKGLCQGLNERLSRIDLRAGQYGVKYAEAKKSPLKPGEQGYKEVASVKY
DPDTYLYQRSEDTTSKLPTHSMFIPFYWGYRASDNEIAKDKRGNPTRLRS
QYQDTAGNRLDANFAKAGGFFVNATSNLPDMYGKGFETTLKTRGVQMVSP
DFTYFGNAPPRRYFVLAAERLAMLVSEIRRLAPDDTITIMGHSQGTMITL
LAQAMLADRRQRCADCLILVDSPYSLLEPKGEEQTTQAKLQTLIKIVKAV
TAQPYTRPALNELQVGQPGYGGRTGHGWTPSQGTRLDAEGKQIVFAERDN
RGKVYLYFCPQDTTVALDQVQGIGTYGVPDTVHVAWKRKFYSTERTASLP
AMDALKDMRFHQRMWTKLLRGGKPVAVGLPPQHIPLRMEDEARYPGGGVG
PTTTASQTPLPQEGRYINGEALQPPHAPQMEDGEADARQYKSSTPLRGTP
TRAGKDAPDDVSVDVALGNPKASLNQYRVFERFVDKNLSDPDLQELTQQF
NANHPDLNDQTPGYDCENGDDMGYMLWRHATPNEVRAQMAHNPAALVDNS
YHSAMLRSTENHRWVTAMDVAIGQAQTLDDPEWRKVLIAFANWRTPFKPS
ESQLPGQLTLLELANFEKLSPGAQMLAQQTAYYYTTGKFPDGVSKEPPDK
YVISRTRAQRAESNE


Reference
    Title: Genome sequence and rapid evolution of the rice pathogen Xanthomonas oryzae pv. oryzae PXO99A
    Salzberg SL, Sommer DD, Schatz MC, Phillippy AM, Rabinowicz PD, Tsuge S, Furutani A, Ochiai H, Delcher AL and Bogdanove AJ <27 more author(s)>
    Ref: BMC Genomics, 9:204, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer