(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Xanthomonadales: NE > Xanthomonadaceae: NE > Xanthomonas: NE > Xanthomonas oryzae: NE > Xanthomonas oryzae pv. oryzae: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Xanthomonas oryzae pv. oryzae MAFF 311018: N, E.
Xanthomonas oryzae pv. oryzae PXO99A: N, E.
Xanthomonas oryzae pv. oryzae KACC 10331: N, E.
Molecular evidence
Database
No mutation 5 structures(e.g. : 3H2G, 3H2H, 3H2I... more)(less) 3H2G: Crystal structure of a rice cell wall degrading esterase LipA from Xanthomonas oryzae, 3H2H: Crystal structure of G231F mutant of the rice cell wall degrading esterase LipA from Xanthomonas oryzae, 3H2I: Crystal structure of N228W mutant of the rice cell wall degrading esterase LipA from Xanthomonas oryzae, 3H2J: Crystal structure of the rice cell wall degrading esterase LipA from Xanthomonas oryzae, 3H2K: Crystal structure of a ligand-bound form of the rice cell wall degrading esterase LipA from Xanthomonas oryzae No kinetic
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MSPARSVLPQESITSMLHINSRSAFGLAAMLGIASAVLAPSAQAAPARGT LLTSNFLTSYTRDAISAMLASGSQPASGSQPEQAKCNVRVAEFTYATIGV EGEPATASGVLLIPGGERCSGPYPLLGWGHPTEALRAQEQAKEIRDAKGD DPLVTRLASQGYVVVGSDYLGLGKSNYAYHPYLHSASEASATIDAMRAAR SVLQHLKTPLSGKVMLSGYSQGGHTAMATQREIEAHLSKEFHLVASAPIS GPYALEQTFLDSWSGSNAVGENTFGILLGSYAIVAMQHTYKNIYLEPGQV FQDPWAAKVEPLFPGKQSLTDMFLNDTLPSIDKVKSYFQPGFYSDFPSNP ANPFRQDLARNNLLEWAPQTPTLLCGSSNDATVPLKNAQTAIASFQQRGS NQVALVDTGTGNASDNSAFAHMLTKESCIVVVRDQLLDKQR
References
Title: A cell wall-degrading esterase of Xanthomonas oryzae requires a unique substrate recognition module for pathogenesis on rice Aparna G, Chatterjee A, Sonti RV, Sankaranarayanan R Ref: Plant Cell, 21:1860, 2009 : PubMed
Xanthomonas oryzae pv oryzae (Xoo) causes bacterial blight, a serious disease of rice (Oryza sativa). LipA is a secretory virulence factor of Xoo, implicated in degradation of rice cell walls and the concomitant elicitation of innate immune responses, such as callose deposition and programmed cell death. Here, we present the high-resolution structural characterization of LipA that reveals an all-helical ligand binding module as a distinct functional attachment to the canonical hydrolase catalytic domain. We demonstrate that the enzyme binds to a glycoside ligand through a rigid pocket comprising distinct carbohydrate-specific and acyl chain recognition sites where the catalytic triad is situated 15 A from the anchored carbohydrate. Point mutations disrupting the carbohydrate anchor site or blocking the pocket, even at a considerable distance from the enzyme active site, can abrogate in planta LipA function, exemplified by loss of both virulence and the ability to elicit host defense responses. A high conservation of the module across genus Xanthomonas emphasizes the significance of this unique plant cell wall-degrading function for this important group of plant pathogenic bacteria. A comparison with the related structural families illustrates how a typical lipase is recruited to act on plant cell walls to promote virulence, thus providing a remarkable example of the emergence of novel functions around existing scaffolds for increased proficiency of pathogenesis during pathogen-plant coevolution.
Title: Functional interplay between two Xanthomonas oryzae pv,. oryzae secretion systems in modulating virulence on rice Jha G, Rajeshwari R, Sonti RV Ref: Mol Plant Microbe Interact, 20:31, 2007 : PubMed
The type II (T2S) and type III (T3S) secretion systems are important for virulence of Xanthomonas oryzae pv. oryzae, causal agent of bacterial leaf blight of rice. The T3S of gram-negative bacterial plant pathogens has been shown to suppress host defense responses, including programmed cell death reactions, whereas the T2S is involved in secreting cell-wall-degrading enzymes. Here, we show that a T3S-deficient (T3S-) mutant of X. oryzae pv. oryzae can induce a basal plant defense response seen as callose deposition, immunize rice against subsequent X. oryzae pv. oryzae infection, and cause cell-death-associated nuclear fragmentation. A T2S- T3S- double mutant exhibited a substantial reduction in the ability to evoke these responses. We purified two major effectors of the X. oryzae pv. oryzae T2S and characterized them to be a cellulase (ClsA) and a putative cellobiosidase (CbsA). The purified ClsA, CbsA, and lipase/esterase (LipA; a previously identified T2S effector) proteins induced rice defense responses that were suppressible by X. oryzae pv. oryzae in a T3S-dependent manner. These defense responses also were inducible by the products of the action of these purified proteins on rice cell walls. We further show that a CbsA- mutant or a ClsA- LipA- double mutant are severely virulence deficient. These results indicate that the X. oryzae pv. oryzae T2S secretes important virulence factors, which induce innate rice defense responses that are suppressed by T3S effectors to enable successful infection.
The nucleotide sequence was determined for the genome of Xanthomonas oryzae pathovar oryzae (Xoo) KACC10331, a bacterium that causes bacterial blight in rice (Oryza sativa L.). The genome is comprised of a single, 4 941 439 bp, circular chromosome that is G + C rich (63.7%). The genome includes 4637 open reading frames (ORFs) of which 3340 (72.0%) could be assigned putative function. Orthologs for 80% of the predicted Xoo genes were found in the previously reported X.axonopodis pv. citri (Xac) and X.campestris pv. campestris (Xcc) genomes, but 245 genes apparently specific to Xoo were identified. Xoo genes likely to be associated with pathogenesis include eight with similarity to Xanthomonas avirulence (avr) genes, a set of hypersensitive reaction and pathogenicity (hrp) genes, genes for exopolysaccharide production, and genes encoding extracellular plant cell wall-degrading enzymes. The presence of these genes provides insights into the interactions of this pathogen with its gramineous host.
Xanthomonas oryzae pv. oryzae Lipase/esterase (Fragment) [lipA] Putative uncharacterized protein
