Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: xanor-q5h5n1

Xanthomonas oryzae, Xanthomonas vasicola, Xanthomonas fuscans; Xanthomonas campestris b-ketoadipate enol-lactone hydrolase

Comment
Other strains: Xanthomonas oryzae, Xanthomonas vasicola, Xanthomonas fuscans; Xanthomonas campestris, pv. oryzae ( and strains MAFF 311018; PXO99A) musacearum NCPPB 4392; punicae LMG 859; citrumelo F1; mangiferaeindicae LMG 941; ; ; viticola; musacearum NCPPB 4384; malvacearum GSPB1386; musacearum NCPPB 2005; bilvae; musacearum NCPPB 4394; malvacearum GSPB2388; musacearum NCPPB 4379; phaseoli; Xac29-1; glycines 8ra; arecae; oryzicola (strain BLS256); vasculorum (NCPPB 1326; NCPPB 895; NCPPB 890; NCPPB 206; NCPPB 1381); phaseoli; musacearum NCPPB 4380


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Xanthomonas oryzae pv. oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Xanthomonadales: N E > Xanthomonadaceae: N E > Xanthomonas: N E > Xanthomonas oryzae: N E > Xanthomonas oryzae pv. oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 58 more: AE013598, AP008229, CP000967
>3 UniProt links 3 more: Q5H5N1, H8FF03, A0A098Q2F0
>3 UniProt links 3 more: Q5H5N1, H8FF03, A0A098Q2F0
>3 Interpro links 3 more: Q5H5N1, H8FF03, A0A098Q2F0
>3 Prodom links 3 more: Q5H5N1, H8FF03, A0A098Q2F0
>3 Pfam links 3 more: Q5H5N1, H8FF03, A0A098Q2F0
>3 PIRSF links 3 more: Q5H5N1, H8FF03, A0A098Q2F0
>3 SUPERFAM links 3 more: Q5H5N1, H8FF03, A0A098Q2F0
Sequence
Graphical view for this peptide sequence: xanor-q5h5n1
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MAYLRLPTHRLHYRLDGTEGRPWLTFCNSLGTDLHLWDVQIEAFAPHYRI
LRYDRRGHGDSETPPGPYSVADLGQDVLALWDALEIAQSDFCGLSIGGLT
GQWLGLHVPHRLRRLVVCATAKKIGSAATWESRIEQVRSEGLPVLIDATL
QRWFTPEFAISHAQRLDMIAAAFVSTSPAGYIACCQALADADFRGALDGL
SVPLLALAGDDDPVCPPSDLREIAYAAPDGHYAQVPGRHICNLESPAAFN
DAVLGFLQAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAYLRLPTHRLHYRLDGTEGRPWLTFCNSLGTDLHLWDVQIEAFAPHYRI
LRYDRRGHGDSETPPGPYSVADLGQDVLALWDALEIAQSDFCGLSIGGLT
GQWLGLHVPHRLRRLVVCATAKKIGSAATWESRIEQVRSEGLPVLIDATL
QRWFTPEFAISHAQRLDMIAAAFVSTSPAGYIACCQALADADFRGALDGL
SVPLLALAGDDDPVCPPSDLREIAYAAPDGHYAQVPGRHICNLESPAAFN
DAVLGFLQAD


References
8 more
    Title: Genome sequence and rapid evolution of the rice pathogen Xanthomonas oryzae pv. oryzae PXO99A
    Salzberg SL, Sommer DD, Schatz MC, Phillippy AM, Rabinowicz PD, Tsuge S, Furutani A, Ochiai H, Delcher AL and Bogdanove AJ <27 more author(s)>
    Ref: BMC Genomics, 9:204, 2008 : PubMed

            

    Title: The genome sequence of Xanthomonas oryzae pathovar oryzae KACC10331, the bacterial blight pathogen of rice
    Lee BM, Park YJ, Park DS, Kang HW, Kim JG, Song ES, Park IC, Yoon UH, Hahn JH and Go SJ <9 more author(s)>
    Ref: Nucleic Acids Research, 33:577, 2005 : PubMed

            

    Title: Genome sequence of Xanthomonas oryzae pv. oryzae suggests contribution of large numbers of effector genes and insertion sequences to its race diversity
    Inoue Y, Takeya M, Sasaki A, Kaki H
    Ref: , 39:275, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer