Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-BST1

Saccharomyces cerevisiae (Baker's yeast), BST1, YFL025C, GPI inositol-deacylase

Comment
Other strains: Saccharomyces cerevisiae (Baker's yeast) (and strains ATCC 204508 / S288c; RM11-1a; Lalvin EC1118 / Prise de mousse; YJM789; AWRI1631; AWRI1631; JAY291; Zymaflore VL3) only n-term Pfam A PGAP1 132 370


Relationship
Family|PGAP1
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: D50617, CH408057, FN393068
>3 UniProt links 4 more: P43571, B3LUI6, C8Z7Q8
>3 UniProt links 4 more: P43571, B3LUI6, C8Z7Q8
>3 Interpro links 4 more: P43571, B3LUI6, C8Z7Q8
>3 Prodom links 4 more: P43571, B3LUI6, C8Z7Q8
>3 Pfam links 4 more: P43571, B3LUI6, C8Z7Q8
>3 PIRSF links 4 more: P43571, B3LUI6, C8Z7Q8
>3 SUPERFAM links 4 more: P43571, B3LUI6, C8Z7Q8
Sequence
Graphical view for this peptide sequence: yeast-BST1
Colored MSA for PGAP1 (raw)
MGIRRLVSVITRPIINKVNSSGQYSRVLATREDQDKASPKYMNNDKIAKK
PYTYRLFSILGILSICSLLLISLLKPFNGADAPQCESIYMFPSYARIDGF
DERYTPLAHKYHLYLYREQSVDREPLNGDELQLDGIPVLFIPGNAGSFRQ
CRSIASACSNIYFDSNTRATLRNENVRNLDFFTADFNEDFTAFHGETMLD
QAEYLNDAIKYILSLYERTPDYPHPKPQSVIIVGHSMGGIVSRVMLTLKN
HVPGSISTILTLSSPHAASPVTFDGDILKLYKNTNEYWRKQLSQNDSFFS
KNISLVSITGGILDTTLPADYASVEDLVSLENGFTSFTTTIPDVWTPIDH
LAIVWCKQLREVLARLLLE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGIRRLVSVITRPIINKVNSSGQYSRVLATREDQDKASPKYMNNDKIAKK
PYTYRLFSILGILSICSLLLISLLKPFNGADAPQCESIYMFPSYARIDGF
DERYTPLAHKYHLYLYREQSVDREPLNGDELQLDGIPVLFIPGNAGSFRQ
CRSIASACSNIYFDSNTRATLRNENVRNLDFFTADFNEDFTAFHGETMLD
QAEYLNDAIKYILSLYERTPDYPHPKPQSVIIVGHSMGGIVSRVMLTLKN
HVPGSISTILTLSSPHAASPVTFDGDILKLYKNTNEYWRKQLSQNDSFFS
KNISLVSITGGILDTTLPADYASVEDLVSLENGFTSFTTTIPDVWTPIDH
LAIVWCKQLREVLARLLLE


References
7 more
    Title: Eukaryote-to-eukaryote gene transfer events revealed by the genome sequence of the wine yeast Saccharomyces cerevisiae EC1118
    Novo M, Bigey F, Beyne E, Galeote V, Gavory F, Mallet S, Cambon B, Legras JL, Wincker P and Dequin S <1 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 106:16333, 2009 : PubMed

            

    Title: Genome sequencing and comparative analysis of Saccharomyces cerevisiae strain YJM789
    Wei W, McCusker JH, Hyman RW, Jones T, Ning Y, Cao Z, Gu Z, Bruno D, Miranda M and Steinmetz LM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:12825, 2007 : PubMed

            

    Title: Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae
    Murakami Y, Naitou M, Hagiwara H, Shibata T, Ozawa M, Sasanuma S, Sasanuma M, Tsuchiya Y, Soeda E and et al. <1 more author(s)>
    Ref: Nat Genet, 10:261, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer