Saccharomyces cerevisiae (Baker's yeast); Saccharomyces arboricola; Saccharomyces eubayanus family of serine hydrolases 1 (EC 3.1.-.-) in aap1-smf2 intergenic region
Comment
Fsh1p was identified as a lysophospholipase that specifically acts on lysophosphatidylserine (LPS) and impacts the lipid homeostasis in S. cerevisiae (Ramachandran_2021). Other strains: Saccharomyces cerevisiae (YJM789; AWRI1631; AWRI796; VIN 13; RM11-1a; Lalvin QA23; FostersO; Zymaflore VL3; JAY291; FostersB; Kyokai no. 7 / NBRC 101557; CEN.PK113-7D) (Baker's yeast)Saccharomyces cerevisiae x kudriavzevii (strain VIN7); Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889); Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644); Saccharomyces eubayanus previously yeast-yhk9
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Saccharomycotina: NE > Saccharomycetes: NE > Saccharomycetales: NE > Saccharomycetaceae: NE > Saccharomyces: NE > Saccharomyces cerevisiae: NE
6_AlphaBeta_hydrolase : yeast-SCYNR064CSaccharomycescerevisiae SCYNR064C, yeast-ynl5Saccharomyces cerevisiae (Baker's yeast) YNL115C hypothetical 74.0 kda protein in mls1-rpc19 intergenic region, yeast-YOR084W Saccharomyces cerevisiae (Baker's yeast) Peroxisomal membrane protein LPX1 chromosome xv reading frame orf yor084w, yeast-ymc0Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). Uncharacterized protein YML020W. A85-EsteraseD-FGH : yeast-yjg8 Saccharomyces cerevisiae (Baker's yeast)) S-formylglutathione hydrolase. ABHD11-Acetyl_transferase : yeast-yg1lSaccharomyces cerevisiae (Baker's yeast) IMO32 hypothetical 38.5 kda protein in erv1-gls2 intergenic region, yeast-yg19Saccharomyces cerevisiae (Baker's yeast) EAT1 YGR015C hypothetical 37.9 kda protein in msb2-uga1 intergenic region. ABHD13-BEM46 : yeast-yn60Saccharomyces cerevisiae (Baker's yeast) hypothetical 32.3 kda protein in kre1-hxt14 intergenic region. abh_upf0017 : yeast-MCFS1Saccharomyces cerevisiae (Baker's yeast) Acyl-coenzymeA:ethanol O-acyltransferase 51.7 kda sec62-msy1 intergenic region ypl095c, yeast-MCFS2Saccharomyces cerevisiae (Baker's yeast) EHT1, MCFS2, YBR177C, YBR1239 alcohol acyl transferase (octanoyl-CoA:ethanol acyltransferase also thioesterase), yeast-ym60Saccharomyces cerevisiae (Baker's yeast) monoacylglycerol lipase YMR210W 51.4 kda protein YM8261.04 in rar1-scj1 intergenic region. Acidic_Lipase : yeast-tgl1Saccharomyces cerevisiae (Baker's yeast) triglyceride lipase-cholesterol esterase (EC 3.1.1.-) Tgl1p, yeast-YLL012WSaccharomyces cerevisiae (Baker's yeast) chromosome xii yll012w Yeh1p Steryl ester hydrolase, yeast-YLR020CSaccharomyces cerevisiae (Baker's yeast) chromosome xii ylr020c Yeh2p. AlphaBeta_hydrolase : yeast-LDH1Saccharomyces cerevisiae (Yeast) Lipid droplet hydrolase 1 chromosome II reading frame ORF YBR204c, yeast-YDL057WSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl057w. Arb2_domain : yeast-hda1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces cerevisiae x Saccharomyces kudriavzevii . Histone deacetylase HDA1 (only c-term Arb2 domain). Carboxypeptidase_S10 : yeast-cbpy1 Saccharomyces cerevisiae Carboxypeptidase Y, vacuolar PRC1 gene encoding preproprotein carboxypeptidase Y (CPY), yeast-kex01 Saccharomyces cerevisiae, yeast Pheromone-processing carboxypeptidase KEX1, yeast-yby9Saccharomyces cerevisiae chromosome II reading frame ORF YBR139w. CGI-58_ABHD5_ABHD4 : yeast-cld1Saccharomyces cerevisiae (Baker's yeast) YGR110W hypothetical 52.0 kda protein in clb6-shy1 intergenic region, yeast-ECM18Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a; JAY291) hypothetical 53.2 kda extracellular matrix protein 18, yeast-ict1Saccharomyces cerevisiae (Baker's yeast) chromosome XII reading frame orf ylr099c Increased copper tolerance protein 1. Dienelactone_hydrolase : yeast-AIM2Saccharomyces cerevisiae (Baker's yeast) yae9 hypothetical 27.1 kda protein in acs1-gcv3 intergenic region, yeast-dlhhSaccharomyces cerevisiae (Baker's yeast) hydrolase) (dlh). DPP4N_Peptidase_S9 : yeast-dap1Saccharomyces cerevisiae (Baker's yeast) dipeptidyl aminopeptidase (STE13 or YCI1), yeast-dap2Saccharomyces cerevisiae (Baker's yeast) yhr028c gene for dipeptidyl aminopeptidase B (DPAP B). Duf_676 : yeast-ROG1Saccharomyces cerevisiae (Baker's yeast) Putative lipase ROG1 ygo4 78.1 kda protein in tip20-mrf1 intergenic region ygl144c, yeast-YDL109CSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl109c, yeast-YDR444WSaccharomyces cerevisiae (Baker's yeast) d9461.29p, yeast-yo059Saccharomyces cerevisiae (Baker's yeast) Putative lipase YOR059C LPL1 chromosome xv orf yor059c YOR29-10. Duf_726 : yeast-yfd4Saccharomyces cerevisiae (Baker's yeast) (strains YJM789; RM11-1a; AWRI1631) Uncharacterized membrane protein Mil1 YFL034W. FSH1 : yeast-FSH2Saccharomyces cerevisiae (Baker's yeast) hypothetical 24.5 kda protein in erg8-ubp8 intergenic region, yeast-FSH3Saccharomyces cerevisiae (Baker's yeast) hypothetical dihydrofolate reductase. Homoserine_transacetylase : yeast-met2Saccharomyces cerevisiae (Baker's yeast), Saccharomyces sp., Saccharomyces paradoxus, S. uvarum, S. bayanus, S. pastorianus, S carlsbergensis, S. bayanus x S. cerevisiae, Homoserine O-trans-acetylase. Kynurenine-formamidase : yeast-YDR428C Saccharomyces cerevisiae (Baker's yeast); Saccharomyces sp. Kynurenine formamidase KFA d9461.15p. LIDHydrolase : yeast-YPR147CSaccharomyces cerevisiae (Baker's yeast) YPR147cp lipid droplet associated enzyme triacylglycerol lipase and ester hydrolase. Lipase_3 : yeast-ATG15CDS from: Saccharomyces cerevisiae (and strain YJM789) lipase involved in lipid vesicles degradation YCR068W Cytoplasm to vacuole targeting protein 17 ATG15, yeast-yj77Saccharomyces cerevisiae chromosome X reading frame ORF YJR107w. LYsophospholipase_carboxylesterase : yeast-YLR118cSaccharomyces cerevisiae Ylr118c protein and gene in chromosome XII cosmid 9233. Monoglyceridelipase_lysophospholip : yeast-mgll Saccharomyces cerevisiae (Baker's yeast) MGLL Yju3p YKL094W YKL441 Monoglyceride lipase. PC-sterol_acyltransferase : yeast-pdatSaccharomyces cerevisiae (Baker's yeast) phospholipid:diacylglycerol acyltransferase (EC 2.3.1.158) (pdat) LRO1, yeast-yj68Saccharomyces cerevisiae (Baker's yeast) (and strain AWRI1631) hypothetical 74.1 kda protein in acr1-yuh1 intergenic region. PGAP1 : yeast-BST1Saccharomyces cerevisiae (Baker's yeast), BST1, YFL025C, GPI inositol-deacylase, yeast-tgl2Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; JAY291; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a) lipase 2 (EC 3.1.1.3) (triacylglycerol lipase). PPase_methylesterase_euk : yeast-ppme1Saccharomyces cerevisiae (Baker's yeast) protein phosphatase methylesterase 1 (EC 3.1.1.-) (pme-1) (yms2). Steryl_acetyl_hydrolase : yeast-SAY1Saccharomyces cerevisiae (Baker's yeast) hypothetical 48.5da prot YG5J chromosome VII. T6SS-TLE1 : yeasv-e7ltm5Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). YEL023C-like protein
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Saccharomyces cerevisiae S288c: N, E.
Saccharomyces cerevisiae YJM789: N, E.
Saccharomyces cerevisiae RM11-1a: N, E.
Saccharomyces cerevisiae AWRI1631: N, E.
Saccharomyces cerevisiae JAY291: N, E.
Saccharomyces cerevisiae EC1118: N, E.
Saccharomyces cerevisiae AWRI796: N, E.
Saccharomyces cerevisiae Lalvin QA23: N, E.
Saccharomyces cerevisiae Vin13: N, E.
Saccharomyces cerevisiae FostersO: N, E.
Saccharomyces cerevisiae FostersB: N, E.
Saccharomyces cerevisiae VL3: N, E.
Saccharomyces cerevisiae Kyokai no. 7: N, E.
Saccharomyces cerevisiae P301: N, E.
Saccharomyces cerevisiae R103: N, E.
Saccharomyces cerevisiae CEN.PK113-7D: N, E.
Saccharomyces cerevisiae R008: N, E.
Saccharomyces cerevisiae P283: N, E.
Saccharomyces cerevisiae YJM993: N, E.
Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7: N, E.
Saccharomyces kudriavzevii IFO 1802: N, E.
Saccharomyces arboricola H-6: N, E.
Saccharomyces eubayanus: N, E.
Saccharomyces sp. 'boulardii': N, E.
Molecular evidence
Database
No mutation 1 structure: 1YCD: Crystal structure of yeast FSH1/YHR049W, a member of the serine hydrolase family No kinetic
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MTVQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEK KDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKAN GPYDGIVGFSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPE HPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLK AQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEASE
OBJECTIVES: To elucidate the role of FSH1 (family of serine hydrolase) in lipid homeostasis. RESULTS: Proteins in various species containing alpha/beta hydrolase domain are known to be involved in lipid metabolism. In silico analysis of the FSH1 gene in Saccharomyces cerevisiae revealed the presence of alpha/beta hydrolase domain (ABHD) and a lipase motif (GXSXG), however its function in lipid metabolism remained elusive. The overexpression of FSH1 in WT and fsh1delta cells showed a significant reduction in the cellular phospholipid levels and an increase in the triacylglycerol levels and lipid droplet (LD) number. Furthermore, the purified recombinant protein Fsh1p was identified as a lysophospholipase that specifically acts on lysophosphatidylserine (LPS) and impacts the lipid homeostasis in S. cerevisiae. CONCLUSIONS: These results depicted that Fsh1p has a role on lipid homeostasis and is a lysophospholipase that hydrolyzes lysophosphatidylserine (LPS).
        
Title: Comparative analysis of the human serine hydrolase OVCA2 to the model serine hydrolase homolog FSH1 from S. cerevisiae Bun JS, Slack MD, Schemenauer DE, Johnson RJ Ref: PLoS ONE, 15:e0230166, 2020 : PubMed
Over 100 metabolic serine hydrolases are present in humans with confirmed functions in metabolism, immune response, and neurotransmission. Among potentially clinically-relevant but uncharacterized human serine hydrolases is OVCA2, a serine hydrolase that has been linked with a variety of cancer-related processes. Herein, we developed a heterologous expression system for OVCA2 and determined the comprehensive substrate specificity of OVCA2 against two ester substrate libraries. Based on this analysis, OVCA2 was confirmed as a serine hydrolase with a strong preference for long-chain alkyl ester substrates (>10-carbons) and high selectivity against a variety of short, branched, and substituted esters. Substitutional analysis was used to identify the catalytic residues of OVCA2 with a Ser117-His206-Asp179 classic catalytic triad. Comparison of the substrate specificity of OVCA2 to the model homologue FSH1 from Saccharomyces cerevisiae illustrated the tighter substrate selectivity of OVCA2, but their overlapping substrate preference for extended straight-chain alkyl esters. Conformation of the overlapping biochemical properties of OVCA2 and FSH1 was used to model structural information about OVCA2. Together our analysis provides detailed substrate specificity information about a previously, uncharacterized human serine hydrolase and begins to define the biological properties of OVCA2.
        
Title: FSH1 overexpression triggers apoptosis in Saccharomyces cerevisiae Gowsalya R, Ravi C, Arul M, Nachiappan V Ref: Antonie Van Leeuwenhoek, 112:1775, 2019 : PubMed
FSH1 belongs to the family of serine hydrolases in yeast and is homologous to the human ovarian tumor suppressor gene (OVAC2). Our preliminary results showed that cells lacking Fsh1p exhibit an increase in cell growth, and a decrease in the expression of AIF1 and NUC1 (apoptosis responsive genes) when compared to the wild type cells. Growth inhibition of cells overexpressing FSH1 is due to induction of cell death associated with cell death markers typical of mammalian apoptosis namely DNA fragmentation, phosphatidylserine externalization, ROS accumulation, Cytochrome c release, and altered mitochondrial membrane potential. When wild type cells were overexpressed with FSH1 there was up regulation of AIF1 level when compared to control cells suggesting that overexpression of FSH1 regulated cell death in yeast.
OBJECTIVES: To elucidate the role of FSH1 (family of serine hydrolase) in lipid homeostasis. RESULTS: Proteins in various species containing alpha/beta hydrolase domain are known to be involved in lipid metabolism. In silico analysis of the FSH1 gene in Saccharomyces cerevisiae revealed the presence of alpha/beta hydrolase domain (ABHD) and a lipase motif (GXSXG), however its function in lipid metabolism remained elusive. The overexpression of FSH1 in WT and fsh1delta cells showed a significant reduction in the cellular phospholipid levels and an increase in the triacylglycerol levels and lipid droplet (LD) number. Furthermore, the purified recombinant protein Fsh1p was identified as a lysophospholipase that specifically acts on lysophosphatidylserine (LPS) and impacts the lipid homeostasis in S. cerevisiae. CONCLUSIONS: These results depicted that Fsh1p has a role on lipid homeostasis and is a lysophospholipase that hydrolyzes lysophosphatidylserine (LPS).
        
Title: Comparative analysis of the human serine hydrolase OVCA2 to the model serine hydrolase homolog FSH1 from S. cerevisiae Bun JS, Slack MD, Schemenauer DE, Johnson RJ Ref: PLoS ONE, 15:e0230166, 2020 : PubMed
Over 100 metabolic serine hydrolases are present in humans with confirmed functions in metabolism, immune response, and neurotransmission. Among potentially clinically-relevant but uncharacterized human serine hydrolases is OVCA2, a serine hydrolase that has been linked with a variety of cancer-related processes. Herein, we developed a heterologous expression system for OVCA2 and determined the comprehensive substrate specificity of OVCA2 against two ester substrate libraries. Based on this analysis, OVCA2 was confirmed as a serine hydrolase with a strong preference for long-chain alkyl ester substrates (>10-carbons) and high selectivity against a variety of short, branched, and substituted esters. Substitutional analysis was used to identify the catalytic residues of OVCA2 with a Ser117-His206-Asp179 classic catalytic triad. Comparison of the substrate specificity of OVCA2 to the model homologue FSH1 from Saccharomyces cerevisiae illustrated the tighter substrate selectivity of OVCA2, but their overlapping substrate preference for extended straight-chain alkyl esters. Conformation of the overlapping biochemical properties of OVCA2 and FSH1 was used to model structural information about OVCA2. Together our analysis provides detailed substrate specificity information about a previously, uncharacterized human serine hydrolase and begins to define the biological properties of OVCA2.
        
Title: FSH1 overexpression triggers apoptosis in Saccharomyces cerevisiae Gowsalya R, Ravi C, Arul M, Nachiappan V Ref: Antonie Van Leeuwenhoek, 112:1775, 2019 : PubMed
FSH1 belongs to the family of serine hydrolases in yeast and is homologous to the human ovarian tumor suppressor gene (OVAC2). Our preliminary results showed that cells lacking Fsh1p exhibit an increase in cell growth, and a decrease in the expression of AIF1 and NUC1 (apoptosis responsive genes) when compared to the wild type cells. Growth inhibition of cells overexpressing FSH1 is due to induction of cell death associated with cell death markers typical of mammalian apoptosis namely DNA fragmentation, phosphatidylserine externalization, ROS accumulation, Cytochrome c release, and altered mitochondrial membrane potential. When wild type cells were overexpressed with FSH1 there was up regulation of AIF1 level when compared to control cells suggesting that overexpression of FSH1 regulated cell death in yeast.
Bioethanol is a biofuel produced mainly from the fermentation of carbohydrates derived from agricultural feedstocks by the yeast Saccharomyces cerevisiae. One of the most widely adopted strains is PE-2, a heterothallic diploid naturally adapted to the sugar cane fermentation process used in Brazil. Here we report the molecular genetic analysis of a PE-2 derived diploid (JAY270), and the complete genome sequence of a haploid derivative (JAY291). The JAY270 genome is highly heterozygous (approximately 2 SNPs/kb) and has several structural polymorphisms between homologous chromosomes. These chromosomal rearrangements are confined to the peripheral regions of the chromosomes, with breakpoints within repetitive DNA sequences. Despite its complex karyotype, this diploid, when sporulated, had a high frequency of viable spores. Hybrid diploids formed by outcrossing with the laboratory strain S288c also displayed good spore viability. Thus, the rearrangements that exist near the ends of chromosomes do not impair meiosis, as they do not span regions that contain essential genes. This observation is consistent with a model in which the peripheral regions of chromosomes represent plastic domains of the genome that are free to recombine ectopically and experiment with alternative structures. We also explored features of the JAY270 and JAY291 genomes that help explain their high adaptation to industrial environments, exhibiting desirable phenotypes such as high ethanol and cell mass production and high temperature and oxidative stress tolerance. The genomic manipulation of such strains could enable the creation of a new generation of industrial organisms, ideally suited for use as delivery vehicles for future bioenergy technologies.
Saccharomyces cerevisiae has been used for millennia in winemaking, but little is known about the selective forces acting on the wine yeast genome. We sequenced the complete genome of the diploid commercial wine yeast EC1118, resulting in an assembly of 31 scaffolds covering 97% of the S288c reference genome. The wine yeast differed strikingly from the other S. cerevisiae isolates in possessing 3 unique large regions, 2 of which were subtelomeric, the other being inserted within an EC1118 chromosome. These regions encompass 34 genes involved in key wine fermentation functions. Phylogeny and synteny analyses showed that 1 of these regions originated from a species closely related to the Saccharomyces genus, whereas the 2 other regions were of non-Saccharomyces origin. We identified Zygosaccharomyces bailii, a major contaminant of wine fermentations, as the donor species for 1 of these 2 regions. Although natural hybridization between Saccharomyces strains has been described, this report provides evidence that gene transfer may occur between Saccharomyces and non-Saccharomyces species. We show that the regions identified are frequent and differentially distributed among S. cerevisiae clades, being found almost exclusively in wine strains, suggesting acquisition through recent transfer events. Overall, these data show that the wine yeast genome is subject to constant remodeling through the contribution of exogenous genes. Our results suggest that these processes are favored by ecologic proximity and are involved in the molecular adaptation of wine yeasts to conditions of high sugar, low nitrogen, and high ethanol concentrations.
Many industrial strains of Saccharomyces cerevisiae have been selected primarily for their ability to convert sugars into ethanol efficiently despite exposure to a variety of stresses. To begin investigation of the genetic basis of phenotypic variation in industrial strains of S. cerevisiae, we have sequenced the genome of a wine yeast, AWRI1631, and have compared this sequence with both the laboratory strain S288c and the human pathogenic isolate YJM789. AWRI1631 was found to be substantially different from S288c and YJM789, especially at the level of single-nucleotide polymorphisms, which were present, on average, every 150 bp between all three strains. In addition, there were major differences in the arrangement and number of Ty elements between the strains, as well as several regions of DNA that were specific to AWRI1631 and that were predicted to encode proteins that are unique to this industrial strain.
We sequenced the genome of Saccharomyces cerevisiae strain YJM789, which was derived from a yeast isolated from the lung of an AIDS patient with pneumonia. The strain is used for studies of fungal infections and quantitative genetics because of its extensive phenotypic differences to the laboratory reference strain, including growth at high temperature and deadly virulence in mouse models. Here we show that the approximately 12-Mb genome of YJM789 contains approximately 60,000 SNPs and approximately 6,000 indels with respect to the reference S288c genome, leading to protein polymorphisms with a few known cases of phenotypic changes. Several ORFs are found to be unique to YJM789, some of which might have been acquired through horizontal transfer. Localized regions of high polymorphism density are scattered over the genome, in some cases spanning multiple ORFs and in others concentrated within single genes. The sequence of YJM789 contains clues to pathogenicity and spurs the development of more powerful approaches to dissecting the genetic basis of complex hereditary traits.
Yhr049w/FSH1 was recently identified in a combined computational and experimental proteomics analysis for the detection of active serine hydrolases in yeast. This analysis suggested that FSH1 might be a serine-type hydrolase belonging to the broad functional alphabeta-hydrolase superfamily. In order to get insight into the molecular function of this gene, it was targeted in our yeast structural genomics project. The crystal structure of the protein confirms that it contains a Ser/His/Asp catalytic triad that is part of a minimal alpha/beta-hydrolase fold. The architecture of the putative active site and analogies with other protein structures suggest that FSH1 may be an esterase. This finding was further strengthened by the unexpected presence of a compound covalently bound to the catalytic serine in the active site. Apparently, the enzyme was trapped with a reactive compound during the purification process.
An analysis of the structurally and catalytically diverse serine hydrolase protein family in the Saccharomyces cerevisiae proteome was undertaken using two independent but complementary, large-scale approaches. The first approach is based on computational analysis of serine hydrolase active site structures; the second utilizes the chemical reactivity of the serine hydrolase active site in complex mixtures. These proteomics approaches share the ability to fractionate the complex proteome into functional subsets. Each method identified a significant number of sequences, but 15 proteins were identified by both methods. Eight of these were unannotated in the Saccharomyces Genome Database at the time of this study and are thus novel serine hydrolase identifications. Three of the previously uncharacterized proteins are members of a eukaryotic serine hydrolase family, designated as Fsh (family of serine hydrolase), identified here for the first time. OVCA2, a potential human tumor suppressor, and DYR-SCHPO, a dihydrofolate reductase from Schizosaccharomyces pombe, are members of this family. Comparing the combined results to results of other proteomic methods showed that only four of the 15 proteins were identified in a recent large-scale, "shotgun" proteomic analysis and eight were identified using a related, but similar, approach (neither identifies function). Only 10 of the 15 were annotated using alternate motif-based computational tools. The results demonstrate the precision derived from combining complementary, function-based approaches to extract biological information from complex proteomes. The chemical proteomics technology indicates that a functional protein is being expressed in the cell, while the computational proteomics technology adds details about the specific type of function and residue that is likely being labeled. The combination of synergistic methods facilitates analysis, enriches true positive results, and increases confidence in novel identifications. This work also highlights the risks inherent in annotation transfer and the use of scoring functions for determination of correct annotations.
The availability of complete genomic sequences and technologies that allow comprehensive analysis of global expression profiles of messenger RNA have greatly expanded our ability to monitor the internal state of a cell. Yet biological systems ultimately need to be explained in terms of the activity, regulation and modification of proteins--and the ubiquitous occurrence of post-transcriptional regulation makes mRNA an imperfect proxy for such information. To facilitate global protein analyses, we have created a Saccharomyces cerevisiae fusion library where each open reading frame is tagged with a high-affinity epitope and expressed from its natural chromosomal location. Through immunodetection of the common tag, we obtain a census of proteins expressed during log-phase growth and measurements of their absolute levels. We find that about 80% of the proteome is expressed during normal growth conditions, and, using additional sequence information, we systematically identify misannotated genes. The abundance of proteins ranges from fewer than 50 to more than 10(6) molecules per cell. Many of these molecules, including essential proteins and most transcription factors, are present at levels that are not readily detectable by other proteomic techniques nor predictable by mRNA levels or codon bias measurements.
A fundamental goal of cell biology is to define the functions of proteins in the context of compartments that organize them in the cellular environment. Here we describe the construction and analysis of a collection of yeast strains expressing full-length, chromosomally tagged green fluorescent protein fusion proteins. We classify these proteins, representing 75% of the yeast proteome, into 22 distinct subcellular localization categories, and provide localization information for 70% of previously unlocalized proteins. Analysis of this high-resolution, high-coverage localization data set in the context of transcriptional, genetic, and protein-protein interaction data helps reveal the logic of transcriptional co-regulation, and provides a comprehensive view of interactions within and between organelles in eukaryotic cells.
The complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII reveals that it contains 269 predicted or known genes (300 base pairs or larger). Fifty-nine of these genes (22 percent) were previously identified. Of the 210 novel genes, 65 are predicted to encode proteins that are similar to other proteins of known or predicted function. Sixteen genes appear to be relatively recently duplicated. On average, there is one gene approximately every 2 kilobases. Although the coding density and base composition across the chromosome are not uniform, no regular pattern of variation is apparent.