Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-FSH1

Saccharomyces cerevisiae (Baker's yeast); Saccharomyces arboricola; Saccharomyces eubayanus family of serine hydrolases 1 (EC 3.1.-.-) in aap1-smf2 intergenic region

Comment
Fsh1p was identified as a lysophospholipase that specifically acts on lysophosphatidylserine (LPS) and impacts the lipid homeostasis in S. cerevisiae (Ramachandran_2021). Other strains: Saccharomyces cerevisiae (YJM789; AWRI1631; AWRI796; VIN 13; RM11-1a; Lalvin QA23; FostersO; Zymaflore VL3; JAY291; FostersB; Kyokai no. 7 / NBRC 101557; CEN.PK113-7D) (Baker's yeast)Saccharomyces cerevisiae x kudriavzevii (strain VIN7); Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889); Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644); Saccharomyces eubayanus previously yeast-yhk9


Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1YCD: Crystal structure of yeast FSH1/YHR049W, a member of the serine hydrolase family
No kinetic





No Substrate
1 inhbitor:
LI5-1YCD
Sequence
Graphical view for this peptide sequence: yeast-FSH1
Colored MSA for FSH1 (raw)
MTVQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEK
KDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKAN
GPYDGIVGFSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPE
HPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLK
AQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEASE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTVQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEK
KDLPFEMDDEKWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKAN
GPYDGIVGFSQGAALSSIITNKISELVPDHPQFKVSVVISGYSFTEPDPE
HPGELRITEKFRDSFAVKPDMKTKMIFIYGASDQAVPSVRSKYLYDIYLK
AQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQEASE


References
9 more
    Title: FSH1 encodes lysophospholipase activity in Saccharomyces cerevisiae
    Ramachandran G, Chidambaram R, Nachiappan V
    Ref: Biotechnol Lett, 43:279, 2021 : PubMed

            

    Title: Comparative analysis of the human serine hydrolase OVCA2 to the model serine hydrolase homolog FSH1 from S. cerevisiae
    Bun JS, Slack MD, Schemenauer DE, Johnson RJ
    Ref: PLoS ONE, 15:e0230166, 2020 : PubMed

            

    Title: FSH1 overexpression triggers apoptosis in Saccharomyces cerevisiae
    Gowsalya R, Ravi C, Arul M, Nachiappan V
    Ref: Antonie Van Leeuwenhoek, 112:1775, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer