Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-FSH2

Saccharomyces cerevisiae (Baker's yeast) hypothetical 24.5 kda protein in erg8-ubp8 intergenic region

Comment
Other strains: Saccharomyces cerevisiae (strain YJM789; RM11-1a; AWRI1631; JAY291; Lalvin EC1118 / Prise de mousse; Kyokai no. 7 / NBRC 101557; VIN7; Saccharomyces cerevisiae x kudriavzevii (strain VIN7); Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889)


Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: yeast-FSH2
Colored MSA for FSH1 (raw)
MTKNVLMLHGLAQSGDYFASKTKGFRAEMEKLGYKLYYPTAPNEFPPADV
PDFLGEVIADAPGDGENTGVLAWLENDPSTGGYFIPQTTIDYLHNYVLEN
GPFAGIVGFSQGAGVAGYLATDFNGLLGLTTEEQPPLEFFMAVSGFRFQP
QQYQEQYDLHPISVPSLHVQGELDTITEPAKVQGLYNSCTEDSRTLLMHS
GGHFVPNSRGFVRKVAQWLQQLT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTKNVLMLHGLAQSGDYFASKTKGFRAEMEKLGYKLYYPTAPNEFPPADV
PDFLGEVIADAPGDGENTGVLAWLENDPSTGGYFIPQTTIDYLHNYVLEN
GPFAGIVGFSQGAGVAGYLATDFNGLLGLTTEEQPPLEFFMAVSGFRFQP
QQYQEQYDLHPISVPSLHVQGELDTITEPAKVQGLYNSCTEDSRTLLMHS
GGHFVPNSRGFVRKVAQWLQQLT


References
1 more
    Title: Synergistic computational and experimental proteomics approaches for more accurate detection of active serine hydrolases in yeast
    Baxter SM, Rosenblum JS, Knutson S, Nelson MR, Montimurro JS, Di Gennaro JA, Speir JA, Burbaum JJ, Fetrow JS
    Ref: Mol Cell Proteomics, 3:209, 2004 : PubMed

            

    Title: Global analysis of protein localization in budding yeast
    Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK
    Ref: Nature, 425:686, 2003 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII
    Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S and Barrell B <12 more author(s)>
    Ref: Nature, 387:90, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer