Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-MCFS1

Saccharomyces cerevisiae (Baker's yeast) Acyl-coenzymeA:ethanol O-acyltransferase 51.7 kda sec62-msy1 intergenic region ypl095c

Comment
Other strains: Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse; RM11-1a; AWRI1631; YJM789; ATCC 204508 / S288c; VIN 13; Zymaflore VL3; JAY291; FostersB) (Baker's yeast)


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : U43281, AY692561
>3 UniProt links 4 more: Q02891, C8ZIT5, B3LKX8
>3 UniProt links 4 more: Q02891, C8ZIT5, B3LKX8
>3 Interpro links 4 more: Q02891, C8ZIT5, B3LKX8
>3 Prodom links 4 more: Q02891, C8ZIT5, B3LKX8
>3 Pfam links 4 more: Q02891, C8ZIT5, B3LKX8
>3 PIRSF links 4 more: Q02891, C8ZIT5, B3LKX8
>3 SUPERFAM links 4 more: Q02891, C8ZIT5, B3LKX8
1 SGD : S0006016
Sequence
Graphical view for this peptide sequence: yeast-MCFS1
Colored MSA for abh_upf0017 (raw)
MFRSGYYPTVTPSHWGYNGTVKHVLGEKGTKSLAFRDSKRQIPLHEFVTK
HVPTLKDGANFRLNSLLFTGYLQTLYLSAGDFSKKFQVFYGREIIKFSDG
GVCTADWVMPEWEQTYSLNAEKASFNEKQFSNDEKATHPKGWPRLHPRTR
YLSSEELEKCHSKGYSYPLVVVLHGLAGGSHEPLIRALSEDLSKVGDGKF
QVVVLNARGCSRSKVTTRRIFTALHTGDVREFLNHQKALFPQRKIYAVGT
SFGAAMLTNYLGEEGDNCPLNAAVALSNPWDFVHTWDKLAHDWWSNHIFS
RTLTQFLTRTVKVNMNELQVPENFEVSHKPTVEKPVFYTYTRENLEKAEK
FTDILEFDNLFTAPSMGLPDGLTYYRKASSINRLPNIKIPTLIINATDDP
VTGENVIPYKQARENPCVLLCETDLGGHLAYLDNESNSWLTKQAAEFLGS
FDELVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFRSGYYPTVTPSHWGYNGTVKHVLGEKGTKSLAFRDSKRQIPLHEFVTK
HVPTLKDGANFRLNSLLFTGYLQTLYLSAGDFSKKFQVFYGREIIKFSDG
GVCTADWVMPEWEQTYSLNAEKASFNEKQFSNDEKATHPKGWPRLHPRTR
YLSSEELEKCHSKGYSYPLVVVLHGLAGGSHEPLIRALSEDLSKVGDGKF
QVVVLNARGCSRSKVTTRRIFTALHTGDVREFLNHQKALFPQRKIYAVGT
SFGAAMLTNYLGEEGDNCPLNAAVALSNPWDFVHTWDKLAHDWWSNHIFS
RTLTQFLTRTVKVNMNELQVPENFEVSHKPTVEKPVFYTYTRENLEKAEK
FTDILEFDNLFTAPSMGLPDGLTYYRKASSINRLPNIKIPTLIINATDDP
VTGENVIPYKQARENPCVLLCETDLGGHLAYLDNESNSWLTKQAAEFLGS
FDELVL


References
5 more
    Title: Eukaryote-to-eukaryote gene transfer events revealed by the genome sequence of the wine yeast Saccharomyces cerevisiae EC1118
    Novo M, Bigey F, Beyne E, Galeote V, Gavory F, Mallet S, Cambon B, Legras JL, Wincker P and Dequin S <1 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 106:16333, 2009 : PubMed

            

    Title: Global analysis of protein expression in yeast
    Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
    Ref: Nature, 425:737, 2003 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI
    Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B and Hani J <79 more author(s)>
    Ref: Nature, 387:103, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer