Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-YDL109C

Saccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl109c

Comment
Other strains: Saccharomyces cerevisiae (strain RM11-1a; Zymaflore VL3; Lalvin QA23; AWRI796; ATCC 204508 / S288c; LalvinEC1118/Prise de mousse; YJM789; JAY291; FostersO) (Baker's yeast)


Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : Z74157, X95644
>3 UniProt links 2 more: Q12103, B3LH00, C8Z6J5
>3 UniProt links 2 more: Q12103, B3LH00, C8Z6J5
>3 Interpro links 2 more: Q12103, B3LH00, C8Z6J5
>3 Prodom links 2 more: Q12103, B3LH00, C8Z6J5
>3 Pfam links 2 more: Q12103, B3LH00, C8Z6J5
>3 PIRSF links 2 more: Q12103, B3LH00, C8Z6J5
>3 SUPERFAM links 2 more: Q12103, B3LH00, C8Z6J5
Sequence
Graphical view for this peptide sequence: yeast-YDL109C
Colored MSA for Duf_676 (raw)
MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVK
IKNTTKLSYKPAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQA
QQKFIAELSLHHIKPRYVWIVDIVSQILFNKETKVTFEIVVGNSKASLKR
KIRCNDSLPDKACNILHTGLSVHRLTTADIWKVPRPIDMSQKSHLVILTH
GFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKGIKFLGV
GLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEP
INFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLL
YLLSEESLISVLARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLG
GQTTAPCDPLFQPEVSPIGELPNHSDVANDDDGINASSWNTFWKSKENNC
DKKSKRLMNASVIKSMKSVLLSPCPDAKFFSDPDARVATIIHDKIYTEKN
LPPPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHWRKVVVLLKPD
AHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQDKQFAEEDINM
ATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQLASSWISKHSSVTD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEAGRSADEVLYHNQSSVKLGELERYVITYELYQGDSIPADITLDSLWVK
IKNTTKLSYKPAYLLGPFILYCDVRAKDYESSYKIICSADKPVFQSNLQA
QQKFIAELSLHHIKPRYVWIVDIVSQILFNKETKVTFEIVVGNSKASLKR
KIRCNDSLPDKACNILHTGLSVHRLTTADIWKVPRPIDMSQKSHLVILTH
GFQSNVSADMEYLMEEIYKAQMNNPNERLVIKGYMKNACETEKGIKFLGV
GLANYIIDELYDDSVGKISFIGHSLGGLTQTFAICYIKTKYPYFFKKVEP
INFISLASPLLGIATSTPNYVKMSLSMGIIGTTGQELGLKDGNYGDKPLL
YLLSEESLISVLARFKRRTLYANAVNDGIVPLYSSSLLFLDYSQLLQKLG
GQTTAPCDPLFQPEVSPIGELPNHSDVANDDDGINASSWNTFWKSKENNC
DKKSKRLMNASVIKSMKSVLLSPCPDAKFFSDPDARVATIIHDKIYTEKN
LPPPSPTLYEGTAAKEGETRKTRKEMEEIIARRWHKGMHWRKVVVLLKPD
AHNNIIVRRRFSNAYGWPVVDHLVTAHFQRDDPIASPMQDKQFAEEDINM
ATGGVEPNKFYSWLTKIEDPSVYHGGIVSTASQLASSWISKHSSVTD


References
5 more
    Title: Molecular cloning and expression of subunit 9 of the 26S proteasome
    Hoffman L, Rechsteiner M
    Ref: FEBS Letters, 404:179, 1997 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome IV
    Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A and Zaccaria P <126 more author(s)>
    Ref: Nature, 387:75, 1997 : PubMed

            

    Title: The sequence of a 16,691 bp segment of Saccharomyces cerevisiae chromosome IV identifies the DUN1, PMT1, PMT5, SRP14 and DPR1 genes, and five new open reading frames
    Boskovic J, Soler-Mira A, Garcia-Cantalejo JM, Ballesta JP, Jimenez A, Remacha M
    Ref: Yeast, 12:1377, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer