Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-YDR428C

Saccharomyces cerevisiae (Baker's yeast); Saccharomyces sp. Kynurenine formamidase KFA d9461.15p

Comment
Catalyzes the hydrolysis of N-formyl-L-kynurenine to L-kynurenine, the second step in the kynurenine pathway of tryptophan degradation. Kynurenine may be further oxidized to nicotinic acid, NAD(H) and NADP(H). Required for elimination of toxic metabolites. Other strains: Saccharomyces cerevisiae (strains FostersB; Zymaflore VL3; JAY291; AWRI796; Lalvin QA23; YJM789; AWRI1631; ATCC 204508 / S288c; RM11-1a; YJM993; P301; R103; Kyokai no. 7 / NBRC 101557; CEN.PK113-7D; R008; P283); Saccharomyces sp.


Relationship
Family|Kynurenine-formamidase
Block| H
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
1VKH: Crystal structure of putative serine hydrolase (ydr428c) from Saccharomyces cerevisiae at 1.85 A resolution
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: yeast-YDR428C
Colored MSA for Kynurenine-formamidase (raw)
MSNTVRAISPDITLFNKTLTFQEISQNTREAVIYIHGGAWNDPENTPNDF
NQLANTIKSMDTESTVCQYSIEYRLSPEITNPRNLYDAVSNITRLVKEKG
LTNINMVGHSVGATFIWQILAALKDPQEKMSEAQLQMLGLLQIVKRVFLL
DGIYSLKELLVEYPEYDCFTRLAFPDGIQMYEEEPSRVMPYVKKALSRFS
IDMHLVHSYSDELLTLRQTNCLISCLQDYQLSFKLYLDDLGLHNDVYKNG
KVAKYIFDNIC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNTVRAISPDITLFNKTLTFQEISQNTREAVIYIHGGAWNDPENTPNDF
NQLANTIKSMDTESTVCQYSIEYRLSPEITNPRNLYDAVSNITRLVKEKG
LTNINMVGHSVGATFIWQILAALKDPQEKMSEAQLQMLGLLQIVKRVFLL
DGIYSLKELLVEYPEYDCFTRLAFPDGIQMYEEEPSRVMPYVKKALSRFS
IDMHLVHSYSDELLTLRQTNCLISCLQDYQLSFKLYLDDLGLHNDVYKNG
KVAKYIFDNIC


References
11 more
    Title: Genome structure of a Saccharomyces cerevisiae strain widely used in bioethanol production
    Argueso JL, Carazzolle MF, Mieczkowski PA, Duarte FM, Netto OV, Missawa SK, Galzerani F, Costa GG, Vidal RO and Pereira GA <11 more author(s)>
    Ref: Genome Res, 19:2258, 2009 : PubMed

            

    Title: Identification of formyl kynurenine formamidase and kynurenine aminotransferase from Saccharomyces cerevisiae using crystallographic, bioinformatic and biochemical evidence
    Wogulis M, Chew ER, Donohoue PD, Wilson DK
    Ref: Biochemistry, 47:1608, 2008 : PubMed

            

    Title: Genome sequencing and comparative analysis of Saccharomyces cerevisiae strain YJM789
    Wei W, McCusker JH, Hyman RW, Jones T, Ning Y, Cao Z, Gu Z, Bruno D, Miranda M and Steinmetz LM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:12825, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer