Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-YDR444W

Saccharomyces cerevisiae (Baker's yeast) d9461.29p

Comment
Other strains: Saccharomyces cerevisiae (strains JAY291; Lalvin EC1118 / Prise de mousse; RM11-1a; AWRI1631; YJM789; FostersO; VIN 13; Lalvin QA23; ATCC 204508 / S288c) (Baker's yeast)


Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : U33007
>3 UniProt links 3 more: Q04093, C7GTP6, C8Z603
>3 UniProt links 3 more: Q04093, C7GTP6, C8Z603
>3 Interpro links 3 more: Q04093, C7GTP6, C8Z603
>3 Prodom links 3 more: Q04093, C7GTP6, C8Z603
>3 Pfam links 3 more: Q04093, C7GTP6, C8Z603
>3 PIRSF links 3 more: Q04093, C7GTP6, C8Z603
>3 SUPERFAM links 3 more: Q04093, C7GTP6, C8Z603
Sequence
Graphical view for this peptide sequence: yeast-YDR444W
Colored MSA for Duf_676 (raw)
MPYKINRMKNSLEINETGGTLLVDERKRLRIGELYRYKFSVNKDVIKEQG
LDVSHLFLRIKNEESALLRPLYLTGPYSFYIDVRPHNYNENRKFPGKEII
PFVENLKPDERFKVKILLNENSRVGDTSLYSWTIDIISQLAVTTIPKLEF
SFRIGTTRKVVKKSNGLFKSIEGVSLEMWDTETLWDLPPKFPEKPVHLVI
MTHGIFSNIGCDMLYMKDKIEEMTFPMDESINPNIIVRGFMGNVGKSGHG
IHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIK
RPDFFDAVKGVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDL
NLKYTPLTSKDGLYADDEVYPEHSKYILEILPQAPAKKVFESFKRRTIYA
NVMDDGIVPLRTAALLYLDWRSIHKVQKIRKKNKNSPTSSEFVSSDSPES
SGASSPSNENGNNVGEIPAESPNKKATLQWTLPQAVIHGSKINKYKRGQT
NEANSDSDNEQGVFLDGQKFEPPKEANTVLSALSVLTAAIPDQEYIKNPA
VRKDEVIHDKLYHPEELPPPHYENRPIVKKLIYPNESVNRIQERIAREWQ
ETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHFGSKVCSE
LAEDANEPKDEPNQSSQADRSNEYNEGEISKGAENAT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPYKINRMKNSLEINETGGTLLVDERKRLRIGELYRYKFSVNKDVIKEQG
LDVSHLFLRIKNEESALLRPLYLTGPYSFYIDVRPHNYNENRKFPGKEII
PFVENLKPDERFKVKILLNENSRVGDTSLYSWTIDIISQLAVTTIPKLEF
SFRIGTTRKVVKKSNGLFKSIEGVSLEMWDTETLWDLPPKFPEKPVHLVI
MTHGIFSNIGCDMLYMKDKIEEMTFPMDESINPNIIVRGFMGNVGKSGHG
IHCLGVRVGKYVLETVDKLNKKYKVDRISFIGHSLGGPTQSMAVRYISIK
RPDFFDAVKGVKPVNFITLASPFIGVIGDFPFYLSVPLDMGALGLTGRDL
NLKYTPLTSKDGLYADDEVYPEHSKYILEILPQAPAKKVFESFKRRTIYA
NVMDDGIVPLRTAALLYLDWRSIHKVQKIRKKNKNSPTSSEFVSSDSPES
SGASSPSNENGNNVGEIPAESPNKKATLQWTLPQAVIHGSKINKYKRGQT
NEANSDSDNEQGVFLDGQKFEPPKEANTVLSALSVLTAAIPDQEYIKNPA
VRKDEVIHDKLYHPEELPPPHYENRPIVKKLIYPNESVNRIQERIAREWQ
ETMTWRKVLVQIQPDSHNNIVVRRRFVNLYGYVAVEHMVEHHFGSKVCSE
LAEDANEPKDEPNQSSQADRSNEYNEGEISKGAENAT


References
5 more
    Title: Genome structure of a Saccharomyces cerevisiae strain widely used in bioethanol production
    Argueso JL, Carazzolle MF, Mieczkowski PA, Duarte FM, Netto OV, Missawa SK, Galzerani F, Costa GG, Vidal RO and Pereira GA <11 more author(s)>
    Ref: Genome Res, 19:2258, 2009 : PubMed

            

    Title: Eukaryote-to-eukaryote gene transfer events revealed by the genome sequence of the wine yeast Saccharomyces cerevisiae EC1118
    Novo M, Bigey F, Beyne E, Galeote V, Gavory F, Mallet S, Cambon B, Legras JL, Wincker P and Dequin S <1 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 106:16333, 2009 : PubMed

            

    Title: Comparative genome analysis of a Saccharomyces cerevisiae wine strain
    Borneman AR, Forgan AH, Pretorius IS, Chambers PJ
    Ref: FEMS Yeast Res, 8:1185, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer