Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-YLR118c

Saccharomyces cerevisiae Ylr118c protein and gene in chromosome XII cosmid 9233

Comment
Other strains: Saccharomyces cerevisiae (strains FostersO; JAY291; VIN 13; RM11-1a; AWRI1631; FostersB; Zymaflore VL3; YJM789; AWRI796; Lalvin QA23) (Baker's yeast)


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: U53877, Y13138, X89514
>3 UniProt links 3 more: Q12354, C7GQD3, B3LT83
1 Ncbi-nid : 1256856
1 Ncbi-pid : 1256859
>3 UniProt links 3 more: Q12354, C7GQD3, B3LT83
>3 Interpro links 3 more: Q12354, C7GQD3, B3LT83
>3 Prodom links 3 more: Q12354, C7GQD3, B3LT83
>3 Pfam links 3 more: Q12354, C7GQD3, B3LT83
>3 PIRSF links 3 more: Q12354, C7GQD3, B3LT83
>3 SUPERFAM links 3 more: Q12354, C7GQD3, B3LT83
1 SGD : S0004108
Sequence
Graphical view for this peptide sequence: yeast-YLR118c
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MNGLRVAAKIQPARQTIIFLHGLGDTGSGWGFLAQYLQQRDPAAFQHTNF
VFPNAPELHVTANGGALMPAWFDILEWDPSFSKVDSDGFMNSLNSIEKTV
KQEIDKGIKPEQIIIGGFSQGAALALATSVTLPWKIGGIVALSGFCSIPG
ILKQHKNGINVKTPIFHGHGDMDPVVPIGLGIKAKQFYQDSCEIQNYEFK
VYKGMAHSTVPDELEDLASFIKKSLSS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNGLRVAAKIQPARQTIIFLHGLGDTGSGWGFLAQYLQQRDPAAFQHTNF
VFPNAPELHVTANGGALMPAWFDILEWDPSFSKVDSDGFMNSLNSIEKTV
KQEIDKGIKPEQIIIGGFSQGAALALATSVTLPWKIGGIVALSGFCSIPG
ILKQHKNGINVKTPIFHGHGDMDPVVPIGLGIKAKQFYQDSCEIQNYEFK
VYKGMAHSTVPDELEDLASFIKKSLSS


References
7 more
    Title: Characterization of Saccharomyces cerevisiae acyl-protein thioesterase 1, the enzyme responsible for G protein alpha subunit deacylation in vivo
    Duncan JA, Gilman AG
    Ref: Journal of Biological Chemistry, 277:31740, 2002 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XII
    Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H and Hoheisel JD <47 more author(s)>
    Ref: Nature, 387:87, 1997 : PubMed

            

    Title: Sequence analysis of a 37.6 kbp cosmid clone from the right arm of Saccharomyces cerevisiae chromosome XII, carrying YAP3, HOG1, SNR6, tRNA-Arg3 and 23 new open reading frames, among which several homologies to proteins involved in cell division control and to mammalian growth factors and other animal proteins are found
    Verhasselt P, Volckaert G
    Ref: Yeast, 13:241, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer