Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-YOR084W

Saccharomyces cerevisiae (Baker's yeast) Peroxisomal membrane protein LPX1 chromosome xv reading frame orf yor084w

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2Y6U, 2Y6V
No kinetic





No Substrate
No inhibitor
2 Genbank : Z74992, X94335
2 Structure : 2Y6U, 2Y6V
1 UniProt : Q12405
1 Interpro : Q12405
1 Prodom : Q12405
1 Pfam : Q12405
1 PIRSF : Q12405
1 SUPERFAM : Q12405
Sequence
Graphical view for this peptide sequence: yeast-YOR084W
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MEQNRFKKETKTCSASWPRAPQSTLCATDRLELTYDVYTSAERQRRSRTA
TRLNLVFLHGSGMSKVVWEYYLPRLVAADAEGNYAIDKVLLIDQVNHGDS
AVRNRGRLGTNFNWIDGARDVLKIATCELGSIDSHPALNVVIGHSMGGFQ
ALACDVLQPNLFHLLILIEPVVITRKAIGAGRPGLPPDSPQIPENLYNSL
RLKTCDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKASGDDEDG
GPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWCPP
QNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPL
QSSHIPQLTLEERAVMFDRAFDSFKNEALVKTTKQKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEQNRFKKETKTCSASWPRAPQSTLCATDRLELTYDVYTSAERQRRSRTA
TRLNLVFLHGSGMSKVVWEYYLPRLVAADAEGNYAIDKVLLIDQVNHGDS
AVRNRGRLGTNFNWIDGARDVLKIATCELGSIDSHPALNVVIGHSMGGFQ
ALACDVLQPNLFHLLILIEPVVITRKAIGAGRPGLPPDSPQIPENLYNSL
RLKTCDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKASGDDEDG
GPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWCPP
QNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPL
QSSHIPQLTLEERAVMFDRAFDSFKNEALVKTTKQKL


References
3 more
    Title: Rsf1p is required for an efficient metabolic shift from fermentative to glycerol-based respiratory growth in S. cerevisiae
    Roberts GG, 3rd, Hudson AP
    Ref: Yeast, 26:95, 2009 : PubMed

            

    Title: Lpx1p is a peroxisomal lipase required for normal peroxisome morphology
    Thoms S, Debelyy MO, Nau K, Meyer HE, Erdmann R
    Ref: Febs J, 275:504, 2008 : PubMed

            

    Title: DNA sequencing and analysis of 130 kb from yeast chromosome XV
    Voss H, Benes V, Andrade MA, Valencia A, Rechmann S, Teodoru C, Schwager C, Paces V, Sander C, Ansorge W
    Ref: Yeast, 13:655, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer