Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-YPR147C

Saccharomyces cerevisiae (Baker's yeast) YPR147cp lipid droplet associated enzyme triacylglycerol lipase and ester hydrolase

Comment
Other strains: Saccharomyces cerevisiae (RM11-1a; AWRI1631; YJM789; JAY291; Zymaflore VL3; FostersB; VIN 13; FostersO; Lalvin QA23; AWRI796; Lalvin EC1118 / Prise de mousse) (Baker's yeast)


Relationship
Family|LIDHydrolase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: U40829, AAFW02000135, ABSV01002438
>3 UniProt links 3 more: Q06522, A6ZX23, B5VTT2
>3 UniProt links 3 more: Q06522, A6ZX23, B5VTT2
>3 Interpro links 3 more: Q06522, A6ZX23, B5VTT2
>3 Prodom links 3 more: Q06522, A6ZX23, B5VTT2
>3 Pfam links 3 more: Q06522, A6ZX23, B5VTT2
>3 PIRSF links 3 more: Q06522, A6ZX23, B5VTT2
>3 SUPERFAM links 3 more: Q06522, A6ZX23, B5VTT2
Sequence
Graphical view for this peptide sequence: yeast-YPR147C
Colored MSA for LIDHydrolase (raw)
MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLH
HLHLKHPDWEILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKN
RKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKM
TAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGCGSTGYQAVL
STRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFL
FSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI
NAFF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLH
HLHLKHPDWEILGISHAGMTLNAHSNTPIFSLQDQVDHQVEVINNFSCKN
RKIIIMGHSVGAYIVQKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKM
TAALRYIPPLAHVVSLFSYIFFYWILSEGFSRFIIDKFMGCGSTGYQAVL
STRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRFINYCEENGISIWFL
FSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHAEYAI
NAFF


References
5 more
    Title: Molecular modeling, docking and dynamics analysis of lipid droplet associated enzyme Ypr147cp from Saccharomyces cerevisiae
    Sesham K, Manda NK
    Ref: Bioinformation, 17:132, 2021 : PubMed

            

    Title: Saccharomyces cerevisiae lipid droplet associated enzyme Ypr147cp shows both TAG lipase and ester hydrolase activities
    Manda NK, Thunuguntla VBSC, Bokka CS, Singh BJ
    Ref: J Gen Appl Microbiol, 64:76, 2018 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI
    Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B and Hani J <79 more author(s)>
    Ref: Nature, 387:103, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer