(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Fungi: NE > Dikarya: NE > Ascomycota: NE > saccharomyceta: NE > Saccharomycotina: NE > Saccharomycetes: NE > Saccharomycetales: NE > Saccharomycetaceae: NE > Saccharomyces: NE > Saccharomyces cerevisiae: NE
6_AlphaBeta_hydrolase : yeast-SCYNR064CSaccharomycescerevisiae SCYNR064C, yeast-ynl5Saccharomyces cerevisiae (Baker's yeast) YNL115C hypothetical 74.0 kda protein in mls1-rpc19 intergenic region, yeast-YOR084W Saccharomyces cerevisiae (Baker's yeast) Peroxisomal membrane protein LPX1 chromosome xv reading frame orf yor084w, yeast-ymc0Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). Uncharacterized protein YML020W. A85-EsteraseD-FGH : yeast-yjg8 Saccharomyces cerevisiae (Baker's yeast)(strains RM11-1a; LalvinEC1118/Prise de mousse; ATCC 204508/S288c; AWRI1631; JAY291; YJM789) Putative uncharacterized protein (EC 3.1.1.1). ABHD11-Acetyl_transferase : yeast-yg1lSaccharomyces cerevisiae (Baker's yeast) IMO32 hypothetical 38.5 kda protein in erv1-gls2 intergenic region, yeast-yg19Saccharomyces cerevisiae (Baker's yeast) EAT1 YGR015C hypothetical 37.9 kda protein in msb2-uga1 intergenic region. ABHD13-BEM46 : yeast-yn60Saccharomyces cerevisiae (Baker's yeast) hypothetical 32.3 kda protein in kre1-hxt14 intergenic region. abh_upf0017 : yeast-MCFS1Saccharomyces cerevisiae (Baker's yeast) Acyl-coenzymeA:ethanol O-acyltransferase 51.7 kda sec62-msy1 intergenic region ypl095c, yeast-MCFS2Saccharomyces cerevisiae (Baker's yeast) EHT1, MCFS2, YBR177C, YBR1239 alcohol acyl transferase (octanoyl-CoA:ethanol acyltransferase also thioesterase), yeast-ym60Saccharomyces cerevisiae (Baker's yeast) monoacylglycerol lipase YMR210W 51.4 kda protein YM8261.04 in rar1-scj1 intergenic region. Acidic_Lipase : yeast-tgl1Saccharomyces cerevisiae (Baker's yeast) triglyceride lipase-cholesterol esterase (EC 3.1.1.-) Tgl1p, yeast-YLL012WSaccharomyces cerevisiae (Baker's yeast) chromosome xii yll012w Yeh1p Steryl ester hydrolase, yeast-YLR020CSaccharomyces cerevisiae (Baker's yeast) chromosome xii ylr020c Yeh2p. AlphaBeta_hydrolase : yeast-LDH1Saccharomyces cerevisiae (Yeast) Lipid droplet hydrolase 1 chromosome II reading frame ORF YBR204c, yeast-YDL057WSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl057w. Arb2_domain : yeast-hda1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces cerevisiae x Saccharomyces kudriavzevii . Histone deacetylase HDA1 (only c-term Arb2 domain). Carboxypeptidase_S10 : yeast-cbpy1 Saccharomyces cerevisiae Carboxypeptidase Y, vacuolar PRC1 gene encoding preproprotein carboxypeptidase Y (CPY), yeast-kex01 Saccharomyces cerevisiae, yeast Pheromone-processing carboxypeptidase KEX1, yeast-yby9Saccharomyces cerevisiae chromosome II reading frame ORF YBR139w. CGI-58_ABHD5_ABHD4 : yeast-ECM18Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a; JAY291) hypothetical 53.2 kda extracellular matrix protein 18, yeast-ict1Saccharomyces cerevisiae (Baker's yeast) chromosome XII reading frame orf ylr099c Increased copper tolerance protein 1. Dienelactone_hydrolase : yeast-AIM2Saccharomyces cerevisiae (Baker's yeast) yae9 hypothetical 27.1 kda protein in acs1-gcv3 intergenic region, yeast-dlhhSaccharomyces cerevisiae (Baker's yeast) hydrolase) (dlh). DPP4N_Peptidase_S9 : yeast-dap1Saccharomyces cerevisiae (Baker's yeast) dipeptidyl aminopeptidase (STE13 or YCI1), yeast-dap2Saccharomyces cerevisiae (Baker's yeast) yhr028c gene for dipeptidyl aminopeptidase B (DPAP B). Duf_676 : yeast-ROG1Saccharomyces cerevisiae (Baker's yeast) Putative lipase ROG1 ygo4 78.1 kda protein in tip20-mrf1 intergenic region ygl144c, yeast-YDL109CSaccharomyces cerevisiae (Baker's yeast) chromosome IV reading frame orf ydl109c, yeast-YDR444WSaccharomyces cerevisiae (Baker's yeast) d9461.29p, yeast-yo059Saccharomyces cerevisiae (Baker's yeast) Putative lipase YOR059C LPL1 chromosome xv orf yor059c YOR29-10. Duf_726 : yeast-yfd4Saccharomyces cerevisiae (Baker's yeast) (strains YJM789; RM11-1a; AWRI1631) Uncharacterized membrane protein Mil1 YFL034W. Duf_2235 : yeasv-e7ltm5Saccharomyces cerevisiae (strain VIN 13) (Baker's yeast). YEL023C-like protein. FSH1 : yeast-FSH1 Saccharomyces cerevisiae (Baker's yeast); Saccharomyces arboricola; Saccharomyces eubayanus family of serine hydrolases 1 (EC 3.1.-.-) in aap1-smf2 intergenic region, yeast-FSH2Saccharomyces cerevisiae (Baker's yeast) hypothetical 24.5 kda protein in erg8-ubp8 intergenic region, yeast-FSH3Saccharomyces cerevisiae (Baker's yeast) hypothetical dihydrofolate reductase. Homoserine_transacetylase : yeast-met2Saccharomyces cerevisiae (Baker's yeast), Saccharomyces sp., Saccharomyces paradoxus, S. uvarum, S. bayanus, S. pastorianus, S carlsbergensis, S. bayanus x S. cerevisiae, Homoserine O-trans-acetylase. Kynurenine-formamidase : yeast-YDR428C Saccharomyces cerevisiae (Baker's yeast); Saccharomyces sp. Kynurenine formamidase KFA d9461.15p. LIDHydrolase : yeast-YPR147CSaccharomyces cerevisiae (Baker's yeast) YPR147cp lipid droplet associated enzyme triacylglycerol lipase and ester hydrolase. Lipase_3 : yeast-ATG15CDS from: Saccharomyces cerevisiae (and strain YJM789) lipase involved in lipid vesicles degradation YCR068W Cytoplasm to vacuole targeting protein 17 ATG15, yeast-yj77Saccharomyces cerevisiae chromosome X reading frame ORF YJR107w. LYsophospholipase_carboxylesterase : yeast-YLR118cSaccharomyces cerevisiae Ylr118c protein and gene in chromosome XII cosmid 9233. Monoglyceridelipase_lysophospholip : yeast-mgll Saccharomyces cerevisiae (Baker's yeast) MGLL Yju3p YKL094W YKL441 Monoglyceride lipase. PC-sterol_acyltransferase : yeast-pdatSaccharomyces cerevisiae (Baker's yeast) phospholipid:diacylglycerol acyltransferase (EC 2.3.1.158) (pdat) LRO1, yeast-yj68Saccharomyces cerevisiae (Baker's yeast) (and strain AWRI1631) hypothetical 74.1 kda protein in acr1-yuh1 intergenic region. PGAP1 : yeast-BST1Saccharomyces cerevisiae (Baker's yeast), BST1, YFL025C, GPI inositol-deacylase, yeast-tgl2Saccharomyces cerevisiae (Baker's yeast) (and strains YJM789; JAY291; AWRI1631; Lalvin EC1118 / Prise de mousse; RM11-1a) lipase 2 (EC 3.1.1.3) (triacylglycerol lipase). PPase_methylesterase_euk : yeast-ppme1Saccharomyces cerevisiae (Baker's yeast) protein phosphatase methylesterase 1 (EC 3.1.1.-) (pme-1) (yms2). Steryl_acetyl_hydrolase : yeast-SAY1Saccharomyces cerevisiae (Baker's yeast) hypothetical 48.5da prot YG5J chromosome VII
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Saccharomyces cerevisiae S288c: N, E.
Saccharomyces cerevisiae YJM789: N, E.
Saccharomyces cerevisiae RM11-1a: N, E.
Saccharomyces cerevisiae AWRI1631: N, E.
Saccharomyces cerevisiae JAY291: N, E.
Saccharomyces cerevisiae EC1118: N, E.
Saccharomyces cerevisiae AWRI796: N, E.
Saccharomyces cerevisiae Lalvin QA23: N, E.
Saccharomyces cerevisiae Vin13: N, E.
Saccharomyces cerevisiae FostersO: N, E.
Saccharomyces cerevisiae FostersB: N, E.
Saccharomyces cerevisiae VL3: N, E.
Saccharomyces cerevisiae Kyokai no. 7: N, E.
Saccharomyces cerevisiae P301: N, E.
Saccharomyces cerevisiae R103: N, E.
Saccharomyces cerevisiae CEN.PK113-7D: N, E.
Saccharomyces cerevisiae R008: N, E.
Saccharomyces cerevisiae P283: N, E.
Saccharomyces cerevisiae YJM993: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MFKSTLNSIIRRPLKGFQLLRGADSSNTRPQSPRASARDVTEKQILRTPS APTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFY PTPSESKTARLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYG AGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSV QDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFK KLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFR QLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLL SFALKCGGEPRLSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGL RVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQKI
Bioethanol is a biofuel produced mainly from the fermentation of carbohydrates derived from agricultural feedstocks by the yeast Saccharomyces cerevisiae. One of the most widely adopted strains is PE-2, a heterothallic diploid naturally adapted to the sugar cane fermentation process used in Brazil. Here we report the molecular genetic analysis of a PE-2 derived diploid (JAY270), and the complete genome sequence of a haploid derivative (JAY291). The JAY270 genome is highly heterozygous (approximately 2 SNPs/kb) and has several structural polymorphisms between homologous chromosomes. These chromosomal rearrangements are confined to the peripheral regions of the chromosomes, with breakpoints within repetitive DNA sequences. Despite its complex karyotype, this diploid, when sporulated, had a high frequency of viable spores. Hybrid diploids formed by outcrossing with the laboratory strain S288c also displayed good spore viability. Thus, the rearrangements that exist near the ends of chromosomes do not impair meiosis, as they do not span regions that contain essential genes. This observation is consistent with a model in which the peripheral regions of chromosomes represent plastic domains of the genome that are free to recombine ectopically and experiment with alternative structures. We also explored features of the JAY270 and JAY291 genomes that help explain their high adaptation to industrial environments, exhibiting desirable phenotypes such as high ethanol and cell mass production and high temperature and oxidative stress tolerance. The genomic manipulation of such strains could enable the creation of a new generation of industrial organisms, ideally suited for use as delivery vehicles for future bioenergy technologies.
We sequenced the genome of Saccharomyces cerevisiae strain YJM789, which was derived from a yeast isolated from the lung of an AIDS patient with pneumonia. The strain is used for studies of fungal infections and quantitative genetics because of its extensive phenotypic differences to the laboratory reference strain, including growth at high temperature and deadly virulence in mouse models. Here we show that the approximately 12-Mb genome of YJM789 contains approximately 60,000 SNPs and approximately 6,000 indels with respect to the reference S288c genome, leading to protein polymorphisms with a few known cases of phenotypic changes. Several ORFs are found to be unique to YJM789, some of which might have been acquired through horizontal transfer. Localized regions of high polymorphism density are scattered over the genome, in some cases spanning multiple ORFs and in others concentrated within single genes. The sequence of YJM789 contains clues to pathogenicity and spurs the development of more powerful approaches to dissecting the genetic basis of complex hereditary traits.
4 lessTitle: CLD1 Reverses the Ubiquinone Insufficiency of Mutant cat5/coq7 in a Saccharomyces cerevisiae Model System Kar A, Beam H, Borror MB, Luckow M, Gao X, Rea SL Ref: PLoS ONE, 11:e0162165, 2016 : PubMed
Ubiquinone (Qn) functions as a mobile electron carrier in mitochondria. In humans, Q biosynthetic pathway mutations lead to Q10 deficiency, a life threatening disorder. We have used a Saccharomyces cerevisiae model of Q6 deficiency to screen for new modulators of ubiquinone biosynthesis. We generated several hypomorphic alleles of coq7/cat5 (clk-1 in Caenorhabditis elegans) encoding the penultimate enzyme in Q biosynthesis which converts 5-demethoxy Q6 (DMQ6) to 5-demethyl Q6, and screened for genes that, when overexpressed, suppressed their inability to grow on non-fermentable ethanol-implying recovery of lost mitochondrial function. Through this approach we identified Cardiolipin-specific Deacylase 1 (CLD1), a gene encoding a phospholipase A2 required for cardiolipin acyl remodeling. Interestingly, not all coq7 mutants were suppressed by Cld1p overexpression, and molecular modeling of the mutant Coq7p proteins that were suppressed showed they all contained disruptions in a hydrophobic alpha-helix that is predicted to mediate membrane-binding. CLD1 overexpression in the suppressible coq7 mutants restored the ratio of DMQ6 to Q6 toward wild type levels, suggesting recovery of lost Coq7p function. Identification of a spontaneous Cld1p loss-of-function mutation illustrated that Cld1p activity was required for coq7 suppression. This observation was further supported by HPLC-ESI-MS/MS profiling of monolysocardiolipin, the product of Cld1p. In summary, our results present a novel example of a lipid remodeling enzyme reversing a mitochondrial ubiquinone insufficiency by facilitating recovery of hypomorphic enzymatic function.
Bioethanol is a biofuel produced mainly from the fermentation of carbohydrates derived from agricultural feedstocks by the yeast Saccharomyces cerevisiae. One of the most widely adopted strains is PE-2, a heterothallic diploid naturally adapted to the sugar cane fermentation process used in Brazil. Here we report the molecular genetic analysis of a PE-2 derived diploid (JAY270), and the complete genome sequence of a haploid derivative (JAY291). The JAY270 genome is highly heterozygous (approximately 2 SNPs/kb) and has several structural polymorphisms between homologous chromosomes. These chromosomal rearrangements are confined to the peripheral regions of the chromosomes, with breakpoints within repetitive DNA sequences. Despite its complex karyotype, this diploid, when sporulated, had a high frequency of viable spores. Hybrid diploids formed by outcrossing with the laboratory strain S288c also displayed good spore viability. Thus, the rearrangements that exist near the ends of chromosomes do not impair meiosis, as they do not span regions that contain essential genes. This observation is consistent with a model in which the peripheral regions of chromosomes represent plastic domains of the genome that are free to recombine ectopically and experiment with alternative structures. We also explored features of the JAY270 and JAY291 genomes that help explain their high adaptation to industrial environments, exhibiting desirable phenotypes such as high ethanol and cell mass production and high temperature and oxidative stress tolerance. The genomic manipulation of such strains could enable the creation of a new generation of industrial organisms, ideally suited for use as delivery vehicles for future bioenergy technologies.
The mitochondrial dimeric phospholipid cardiolipin is characterized by a high degree of unsaturation of its acyl chains, which is important for its functional interaction with mitochondrial enzymes. The unusual fatty acid composition of cardiolipin molecular species emerges from a de novo synthesized "premature" species by extensive acyl chain remodeling that involves as yet only partially identified acyltransferases and phospholipases. Recently, the yeast protein Taz1p was shown to function as a transacylase, which catalyzes the reacylation of monolysocardiolipin to mature cardiolipin. A defect in the orthologous human TAZ gene is associated with Barth syndrome, a severe genetic disorder, which may lead to cardiac failure and death in childhood. We now identified the protein encoded by reading frame YGR110W as a mitochondrial phospholipase, which deacylates de novo synthesized cardiolipin. Ygr110wp has a strong substrate preference for palmitic acid residues and functions upstream of Taz1p, to generate monolysocardiolipin for Taz1p-dependent reacylation with unsaturated fatty acids. We therefore rename the Ygr110wp as Cld1p (cardiolipin-specific deacylase 1).
Saccharomyces cerevisiae has been used for millennia in winemaking, but little is known about the selective forces acting on the wine yeast genome. We sequenced the complete genome of the diploid commercial wine yeast EC1118, resulting in an assembly of 31 scaffolds covering 97% of the S288c reference genome. The wine yeast differed strikingly from the other S. cerevisiae isolates in possessing 3 unique large regions, 2 of which were subtelomeric, the other being inserted within an EC1118 chromosome. These regions encompass 34 genes involved in key wine fermentation functions. Phylogeny and synteny analyses showed that 1 of these regions originated from a species closely related to the Saccharomyces genus, whereas the 2 other regions were of non-Saccharomyces origin. We identified Zygosaccharomyces bailii, a major contaminant of wine fermentations, as the donor species for 1 of these 2 regions. Although natural hybridization between Saccharomyces strains has been described, this report provides evidence that gene transfer may occur between Saccharomyces and non-Saccharomyces species. We show that the regions identified are frequent and differentially distributed among S. cerevisiae clades, being found almost exclusively in wine strains, suggesting acquisition through recent transfer events. Overall, these data show that the wine yeast genome is subject to constant remodeling through the contribution of exogenous genes. Our results suggest that these processes are favored by ecologic proximity and are involved in the molecular adaptation of wine yeasts to conditions of high sugar, low nitrogen, and high ethanol concentrations.
Many industrial strains of Saccharomyces cerevisiae have been selected primarily for their ability to convert sugars into ethanol efficiently despite exposure to a variety of stresses. To begin investigation of the genetic basis of phenotypic variation in industrial strains of S. cerevisiae, we have sequenced the genome of a wine yeast, AWRI1631, and have compared this sequence with both the laboratory strain S288c and the human pathogenic isolate YJM789. AWRI1631 was found to be substantially different from S288c and YJM789, especially at the level of single-nucleotide polymorphisms, which were present, on average, every 150 bp between all three strains. In addition, there were major differences in the arrangement and number of Ty elements between the strains, as well as several regions of DNA that were specific to AWRI1631 and that were predicted to encode proteins that are unique to this industrial strain.
We sequenced the genome of Saccharomyces cerevisiae strain YJM789, which was derived from a yeast isolated from the lung of an AIDS patient with pneumonia. The strain is used for studies of fungal infections and quantitative genetics because of its extensive phenotypic differences to the laboratory reference strain, including growth at high temperature and deadly virulence in mouse models. Here we show that the approximately 12-Mb genome of YJM789 contains approximately 60,000 SNPs and approximately 6,000 indels with respect to the reference S288c genome, leading to protein polymorphisms with a few known cases of phenotypic changes. Several ORFs are found to be unique to YJM789, some of which might have been acquired through horizontal transfer. Localized regions of high polymorphism density are scattered over the genome, in some cases spanning multiple ORFs and in others concentrated within single genes. The sequence of YJM789 contains clues to pathogenicity and spurs the development of more powerful approaches to dissecting the genetic basis of complex hereditary traits.