Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-dap1

Saccharomyces cerevisiae (Baker's yeast) dipeptidyl aminopeptidase (STE13 or YCI1)

Comment
Other strains: Saccharomyces cerevisiae (strains ATCC 204508 / S288c; YJM789; RM11-1a; AWRI1631; JAY291; Lalvin EC1118 / Prise de mousse; Lalvin QA23) (Baker's yeast) Belongs to peptidase family s9B


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: L21944, U08230, X92441
>3 UniProt links 3 more: P33894, A6ZP61, B3LJP2
1 Ncbi-nid : 347196
1 Ncbi-pid : 347197
>3 UniProt links 3 more: P33894, A6ZP61, B3LJP2
>3 Interpro links 3 more: P33894, A6ZP61, B3LJP2
>3 Prodom links 3 more: P33894, A6ZP61, B3LJP2
>3 Pfam links 3 more: P33894, A6ZP61, B3LJP2
>3 PIRSF links 3 more: P33894, A6ZP61, B3LJP2
>3 SUPERFAM links 3 more: P33894, A6ZP61, B3LJP2
1 SGD : S0005745
Sequence
Graphical view for this peptide sequence: yeast-dap1
Colored MSA for DPP4N_Peptidase_S9 (raw)
MSASTHSHKRKNSHLFPQRKSSNSSMDKPFFPNNDSVANTDPQSNENGHT
INEIRPTEATIDVTDVPQTPFLQEQYSMRPRRESFQFNDIENQHHTHSFF
SVNKFNRRWGEWSLPEKRSYVLVFTLIALSVLVLLVILIPSKLLPTKITR
PKTSAGDSSLGKRSFSIENVLNGDFAIPEDTFHFIDPPQRLLGQDSDPGL
YFTTKEIDGHTNFIAKQLFDETFEVNLGGNRFLYEGVEFTVSTVQINYKL
DKLIFGTNLESEFRHSSKGFYWIKDLNTGNIEPILPPEKSDDNYELGLSK
LSYAHFSPAYNYIYFVYENNLFLQQVNSGVAKKVTEDGSKDIFNAKPDWI
YEEEVLASDQAIWWAPDDSKAVFARFNDTSVDDIRLNRYTNMNEAYLSDT
KIKYPKPGFQNPQFDLFLVNLQNGIIYSINTGGQKDSILYNGKWISPDTF
RFEITDRNSKILDVKVYDIPSSQMLTVRNTNSNLFNGWIEKTKDILSIPP
KPELKRMDYGYIDIHADSRGFSHLFYYPTVFAKEPIQLTKGNWEVTGNGI
VGYEYETDTIFFTANEIGVMSQHLYSISLTDSTTQNTFQSLQNPSDKYDF
YDFELSSSARYAISKKLGPDTPIKVAGPLTRVLNVAEIHDDSILQLTKDE
KFKEKIKNYDLPITSYKTMVLDDGVEINYIEIKPANLNPKKKYPILVNIY
GGPGSQTFTTKSSLAFEQAVVSGLDVIVLQIEPRGTGGKGWSFRSWAREK
LGYWEPRDITEVTKKFIQRNSQHIDESKIAIWGWSYGGFTSLKTVELDNG
DTFKYAMAVAPVTNWTLYDSVYTERYMNQPSENHEGYFEVSTIQNFKSFE
SLKRLFIVHGTFDDNVHIQNTFRLVDQLNLLGLTNYDMHIFPDSDHSIRY
HNAQRIVFQKLYYWLRDAFAERFDNTEVLHL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSASTHSHKRKNSHLFPQRKSSNSSMDKPFFPNNDSVANTDPQSNENGHT
INEIRPTEATIDVTDVPQTPFLQEQYSMRPRRESFQFNDIENQHHTHSFF
SVNKFNRRWGEWSLPEKRSYVLVFTLIALSVLVLLVILIPSKLLPTKITR
PKTSAGDSSLGKRSFSIENVLNGDFAIPEDTFHFIDPPQRLLGQDSDPGL
YFTTKEIDGHTNFIAKQLFDETFEVNLGGNRFLYEGVEFTVSTVQINYKL
DKLIFGTNLESEFRHSSKGFYWIKDLNTGNIEPILPPEKSDDNYELGLSK
LSYAHFSPAYNYIYFVYENNLFLQQVNSGVAKKVTEDGSKDIFNAKPDWI
YEEEVLASDQAIWWAPDDSKAVFARFNDTSVDDIRLNRYTNMNEAYLSDT
KIKYPKPGFQNPQFDLFLVNLQNGIIYSINTGGQKDSILYNGKWISPDTF
RFEITDRNSKILDVKVYDIPSSQMLTVRNTNSNLFNGWIEKTKDILSIPP
KPELKRMDYGYIDIHADSRGFSHLFYYPTVFAKEPIQLTKGNWEVTGNGI
VGYEYETDTIFFTANEIGVMSQHLYSISLTDSTTQNTFQSLQNPSDKYDF
YDFELSSSARYAISKKLGPDTPIKVAGPLTRVLNVAEIHDDSILQLTKDE
KFKEKIKNYDLPITSYKTMVLDDGVEINYIEIKPANLNPKKKYPILVNIY
GGPGSQTFTTKSSLAFEQAVVSGLDVIVLQIEPRGTGGKGWSFRSWAREK
LGYWEPRDITEVTKKFIQRNSQHIDESKIAIWGWSYGGFTSLKTVELDNG
DTFKYAMAVAPVTNWTLYDSVYTERYMNQPSENHEGYFEVSTIQNFKSFE
SLKRLFIVHGTFDDNVHIQNTFRLVDQLNLLGLTNYDMHIFPDSDHSIRY
HNAQRIVFQKLYYWLRDAFAERFDNTEVLHL


References
5 more
    Title: Sequence and analysis of a 33 kb fragment from the right arm of chromosome XV of the yeast Saccharomyces cerevisiae
    Galisson F, Dujon B
    Ref: Yeast, 12:877, 1996 : PubMed

            

    Title: Isolation and DNA sequence of the STE13 gene encoding dipeptidyl aminopeptidase
    Anna-Arriola SS, Herskowitz I
    Ref: Yeast, 10:801, 1994 : PubMed

            

    Title: Membrane protein retention in the yeast Golgi apparatus: dipeptidyl aminopeptidase A is retained by a cytoplasmic signal containing aromatic residues
    Nothwehr SF, Roberts CJ, Stevens TH
    Ref: Journal of Cell Biology, 121:1197, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer