Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-dap2

Saccharomyces cerevisiae (Baker's yeast) yhr028c gene for dipeptidyl aminopeptidase B (DPAP B)

Comment
Other strains: Saccharomyces cerevisiae (strains ATCC 204508 / S288c; YJM789; RM11-1a; AWRI1631; JAY291; Lalvin EC1118 / Prise de mousse; Lalvin QA23; Zymaflore VL3) (Baker's yeast)


Relationship
Family|DPP4N_Peptidase_S9
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 7 more: X15484, U10399, AY723822
>3 UniProt links 3 more: P18962, A6ZST4, B3LSE9
1 Ncbi-nid : 3659
1 Ncbi-pid : 3660
>3 UniProt links 3 more: P18962, A6ZST4, B3LSE9
>3 Interpro links 3 more: P18962, A6ZST4, B3LSE9
>3 Prodom links 3 more: P18962, A6ZST4, B3LSE9
>3 Pfam links 3 more: P18962, A6ZST4, B3LSE9
>3 PIRSF links 3 more: P18962, A6ZST4, B3LSE9
>3 SUPERFAM links 3 more: P18962, A6ZST4, B3LSE9
1 SGD : S0001070
Sequence
Graphical view for this peptide sequence: yeast-dap2
Colored MSA for DPP4N_Peptidase_S9 (raw)
MEGGEEEVERIPDELFDTKKKHLLDKLIRVGIILVLLIWGTVLLLKSIPH
HSNTPDYQEPNSNYTNDGKLKVSFSVVRNNTFHPKYHELQWISDNKIESN
DLGLYVTFMNDSYVVKSVYDDSYNNVLLEGKTFIHNGQNLTVESITASPD
LKRLLIRTNSVQNWRHSTFGSYFVYDKSSSSLRRLETVALAIWSPNSNNI
AYVQDNNIYIYSAISKKTIRAVTNDGSSFLFNGKPDWVYEEEVFEDDKAA
WWSPTGDYLAFLKIDESEVGEFIIPYYVQDEKDIYPEMRSIKYPKSGTPN
PHAELWVYSMKDGTSFHPRISGNKKDGSLLITEVTWVGNGNVLVKTTDRS
SDILTVFLIDTIAKDFKRGKERKFNGGWWEITHNTLFIPANETFDRPHNG
YVDILPIGGYNHLAYFENSNSSHYKTLTEGKWEVVNGPLAFDSMENRLYF
ISTRKSSTERHVYYIDLRSPNEIIEVTDTSEDGVYDVSFSSGRRFGLLTY
KGPKVPYQKIVDFHSRKAEKCDKGNVLGKSLYHLEKNEVLTKILEDYAVP
RKSFRELNLGKDEFGKDILVNSYEILPNDFDETLSDHYPVFFFAYGGPNS
QQVVKTFSVGFNEVVASQLNAIVVVVDGRGTGFKGQDFRSLVRDRLGDYE
ARDQISAASLYGSLTFVDPQKISLFGWSYGGYLTLKTLEKDGGRHFKYGM
SVAPVTDWRFYDSVYTERYMHTPQENFDGYVESSVHNVTALAQANRFLLM
HGTGDDNVHFQNSLKFLDLLDLNGVENYDVHVFPDSDHSIRYHNANVIVF
DKLLDWQSVLSMGNLTNELTIYSSSHRDIHKTFSYLHTMYI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEGGEEEVERIPDELFDTKKKHLLDKLIRVGIILVLLIWGTVLLLKSIPH
HSNTPDYQEPNSNYTNDGKLKVSFSVVRNNTFHPKYHELQWISDNKIESN
DLGLYVTFMNDSYVVKSVYDDSYNNVLLEGKTFIHNGQNLTVESITASPD
LKRLLIRTNSVQNWRHSTFGSYFVYDKSSSSLRRLETVALAIWSPNSNNI
AYVQDNNIYIYSAISKKTIRAVTNDGSSFLFNGKPDWVYEEEVFEDDKAA
WWSPTGDYLAFLKIDESEVGEFIIPYYVQDEKDIYPEMRSIKYPKSGTPN
PHAELWVYSMKDGTSFHPRISGNKKDGSLLITEVTWVGNGNVLVKTTDRS
SDILTVFLIDTIAKDFKRGKERKFNGGWWEITHNTLFIPANETFDRPHNG
YVDILPIGGYNHLAYFENSNSSHYKTLTEGKWEVVNGPLAFDSMENRLYF
ISTRKSSTERHVYYIDLRSPNEIIEVTDTSEDGVYDVSFSSGRRFGLLTY
KGPKVPYQKIVDFHSRKAEKCDKGNVLGKSLYHLEKNEVLTKILEDYAVP
RKSFRELNLGKDEFGKDILVNSYEILPNDFDETLSDHYPVFFFAYGGPNS
QQVVKTFSVGFNEVVASQLNAIVVVVDGRGTGFKGQDFRSLVRDRLGDYE
ARDQISAASLYGSLTFVDPQKISLFGWSYGGYLTLKTLEKDGGRHFKYGM
SVAPVTDWRFYDSVYTERYMHTPQENFDGYVESSVHNVTALAQANRFLLM
HGTGDDNVHFQNSLKFLDLLDLNGVENYDVHVFPDSDHSIRYHNANVIVF
DKLLDWQSVLSMGNLTNELTIYSSSHRDIHKTFSYLHTMYI


References
3 more
    Title: Comparative genome analysis of a Saccharomyces cerevisiae wine strain
    Borneman AR, Forgan AH, Pretorius IS, Chambers PJ
    Ref: FEMS Yeast Res, 8:1185, 2008 : PubMed

            

    Title: Genome sequencing and comparative analysis of Saccharomyces cerevisiae strain YJM789
    Wei W, McCusker JH, Hyman RW, Jones T, Ning Y, Cao Z, Gu Z, Bruno D, Miranda M and Steinmetz LM <12 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:12825, 2007 : PubMed

            

    Title: Structure, biosynthesis, and localization of dipeptidyl aminopeptidase B, an integral membrane glycoprotein of the yeast vacuole
    Roberts CJ, Pohlig G, Rothman JH, Stevens TH
    Ref: Journal of Cell Biology, 108:1363, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer