Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-dlhh

Saccharomyces cerevisiae (Baker's yeast) hydrolase) (dlh)

Comment
Other strains: Saccharomyces cerevisiae (strain RM11-1a; AWRI1631; JAY291; Zymaflore VL3; Lalvin EC1118 / Prise de mousse; Lalvin QA23; FostersO; AWRI796; FostersB; VIN 13; YJM789) (Baker's yeast)


Relationship
Family|Dienelactone_hydrolase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : Z74134
>3 UniProt links 3 more: Q07505, B3LGY1, B5VFI0
>3 UniProt links 3 more: Q07505, B3LGY1, B5VFI0
>3 Interpro links 3 more: Q07505, B3LGY1, B5VFI0
>3 Prodom links 3 more: Q07505, B3LGY1, B5VFI0
>3 Pfam links 3 more: Q07505, B3LGY1, B5VFI0
>3 PIRSF links 3 more: Q07505, B3LGY1, B5VFI0
>3 SUPERFAM links 3 more: Q07505, B3LGY1, B5VFI0
1 SGD : S0002244
Sequence
Graphical view for this peptide sequence: yeast-dlhh
Colored MSA for Dienelactone_hydrolase (raw)
MLITETFHDVQTSYGTTLRIYVYSPKIAGYPQAKFPGVILYSEIYQVTGP
VRRFGQRIASEGYVVVAPAIYHNFMGPEALPYDVQGTDIGNEYKIKKPLE
SYDEDNKLCCDLLFQLPQFDGKRIGSTGMCLGGHLAFRALLDKRVTCATC
FFPTDIHSRTLGLGQNDNSLERVSKELGNNQEMVLIFGTADTHVDPQGRD
LIRKTLRDHGVKFTFLEILAAQHAFIRDEFSKGRFDSAITQSCLGFLFEQ
FNRKLRIDLGEFVDDNTPLEHVC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLITETFHDVQTSYGTTLRIYVYSPKIAGYPQAKFPGVILYSEIYQVTGP
VRRFGQRIASEGYVVVAPAIYHNFMGPEALPYDVQGTDIGNEYKIKKPLE
SYDEDNKLCCDLLFQLPQFDGKRIGSTGMCLGGHLAFRALLDKRVTCATC
FFPTDIHSRTLGLGQNDNSLERVSKELGNNQEMVLIFGTADTHVDPQGRD
LIRKTLRDHGVKFTFLEILAAQHAFIRDEFSKGRFDSAITQSCLGFLFEQ
FNRKLRIDLGEFVDDNTPLEHVC


References
2 more
    Title: Genome structure of a Saccharomyces cerevisiae strain widely used in bioethanol production
    Argueso JL, Carazzolle MF, Mieczkowski PA, Duarte FM, Netto OV, Missawa SK, Galzerani F, Costa GG, Vidal RO and Pereira GA <11 more author(s)>
    Ref: Genome Res, 19:2258, 2009 : PubMed

            

    Title: Comparative genome analysis of a Saccharomyces cerevisiae wine strain
    Borneman AR, Forgan AH, Pretorius IS, Chambers PJ
    Ref: FEMS Yeast Res, 8:1185, 2008 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome IV
    Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A and Zaccaria P <126 more author(s)>
    Ref: Nature, 387:75, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer