Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-ict1

Saccharomyces cerevisiae (Baker's yeast) chromosome XII reading frame orf ylr099c Increased copper tolerance protein 1

Comment
Other strains: Saccharomyces cerevisiae (Baker's yeast) (and strains AWRI1631; JAY291; Lalvin EC1118 / Prise de mousse; RM11-1a; YJM789)


Relationship
Family|CGI-58_ABHD5_ABHD4
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 5 more: Z73271, U53876, Z73272
>3 UniProt links 3 more: Q12385, B5VN35, C7GQS2
>3 UniProt links 3 more: Q12385, B5VN35, C7GQS2
>3 Interpro links 3 more: Q12385, B5VN35, C7GQS2
>3 Prodom links 3 more: Q12385, B5VN35, C7GQS2
>3 Pfam links 3 more: Q12385, B5VN35, C7GQS2
>3 PIRSF links 3 more: Q12385, B5VN35, C7GQS2
>3 SUPERFAM links 3 more: Q12385, B5VN35, C7GQS2
1 SGD : S0004089
Sequence
Graphical view for this peptide sequence: yeast-ict1
Colored MSA for CGI-58_ABHD5_ABHD4 (raw)
MWTNTFKWCSKTEKETTTADAKVCASVQGLKALQQQIMDSTTVRGSVNNT
MTPGGINQWHFHNKRANKVCTPTVLIHGYAASSMAFYRTFENLSDNIKDL
YAIDLPANGASEAPALQVNKTKKIKSLRFKHIEDDVVIPVIEKRPPAEDI
KSHLEQYESYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYALKYPDSI
EKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRFI
FENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTV
QPQTIKVFTHLFERNLIARDPIINNVRFLNPATPVMFMYGEHDWMDKYAG
YLTTESMLKNKAKASYVEVPDAGHNLFLDNPQHFASSLVSFLSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWTNTFKWCSKTEKETTTADAKVCASVQGLKALQQQIMDSTTVRGSVNNT
MTPGGINQWHFHNKRANKVCTPTVLIHGYAASSMAFYRTFENLSDNIKDL
YAIDLPANGASEAPALQVNKTKKIKSLRFKHIEDDVVIPVIEKRPPAEDI
KSHLEQYESYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYALKYPDSI
EKLCLISPLGVENSIHAITHKWEPNTTYPLTFTDPSSRYYTRKLNVPRFI
FENQLNVLKWMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTV
QPQTIKVFTHLFERNLIARDPIINNVRFLNPATPVMFMYGEHDWMDKYAG
YLTTESMLKNKAKASYVEVPDAGHNLFLDNPQHFASSLVSFLSK


References
5 more
    Title: Functional analysis of 150 deletion mutants in Saccharomyces cerevisiae by a systematic approach
    Entian KD, Schuster T, Hegemann JH, Becher D, Feldmann H, Guldener U, Gotz R, Hansen M, Hollenberg CP and et al. <24 more author(s)>
    Ref: Molecular & General Genetics, 262:683, 1999 : PubMed

            

    Title: Drug-induced phenotypes provide a tool for the functional analysis of yeast genes
    Launhardt H, Hinnen A, Munder T
    Ref: Yeast, 14:935, 1998 : PubMed

            

    Title: The nucleotide sequence of Saccharomyces cerevisiae chromosome XII
    Johnston M, Hillier L, Riles L, Albermann K, Andre B, Ansorge W, Benes V, Bruckner M, Delius H and Hoheisel JD <47 more author(s)>
    Ref: Nature, 387:87, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer