Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: yeast-met2

Saccharomyces cerevisiae (Baker's yeast), Saccharomyces sp., Saccharomyces paradoxus, S. uvarum, S. bayanus, S. pastorianus, S carlsbergensis, S. bayanus x S. cerevisiae, Homoserine O-trans-acetylase

Comment
Other strains: Saccharomyces cerevisiae (strain ATCC 204508 / S288c; YJM789; AWRI1631; JAY291; Lalvin EC1118 / Prise de mousse; FostersB; FostersO; RM11-1a; Lalvin QA23; Zymaflore VL3) (Baker's yeast), Saccharomyces sp. (IFO 1802; CID1), Saccharomyces paradoxus, Saccharomyces uvarum, Saccharomyces bayanus, Saccharomyces pastorianus, Saccharomyces carlsbergensis, Saccharomyces bayanus x Saccharomyces cerevisiae S6U Q9URR1


Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Saccharomyces cerevisiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetaceae: N E > Saccharomyces: N E > Saccharomyces cerevisiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 16 more: M15675, AJ001940, Z71553
>3 UniProt links 12 more: P08465, Q9Y771, A6ZRG8
>3 UniProt links 18 more: P08465, Q9Y771, A6ZRG8
>3 Interpro links 18 more: P08465, Q9Y771, A6ZRG8
>3 Prodom links 18 more: P08465, Q9Y771, A6ZRG8
>3 Pfam links 18 more: P08465, Q9Y771, A6ZRG8
>3 PIRSF links 18 more: P08465, Q9Y771, A6ZRG8
>3 SUPERFAM links 18 more: P08465, Q9Y771, A6ZRG8
1 SGD : S0005221
Sequence
Graphical view for this peptide sequence: yeast-met2
Colored MSA for Homoserine_transacetylase (raw)
MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF
PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF
IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL
GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS
EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS
RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK
GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG
TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS
DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT
NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF
PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF
IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL
GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS
EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS
RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK
GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG
TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS
DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT
NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW


References
7 more
    Title: A natural chimeric yeast containing genetic material from three species
    Groth C, Hansen J, Piskur J
    Ref: Int J Syst Bacteriol, 49 Pt 4:1933, 1999 : PubMed

            

    Title: New hybrids between Saccharomyces sensu stricto yeast species found among wine and cider production strains
    Masneuf I, Hansen J, Groth C, Piskur J, Dubourdieu D
    Ref: Applied Environmental Microbiology, 64:3887, 1998 : PubMed

            

    Title: The MET2 gene of Saccharomyces cerevisiae: molecular cloning and nucleotide sequence
    Langin T, Faugeron G, Goyon C, Nicolas A, Rossignol JL
    Ref: Gene, 49:283, 1986 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer